Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QJW1

Protein Details
Accession A0A0C3QJW1   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-33EAIPGRTNKACRKRWKHSLHPSIKKTPWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
IPR017884  SANT_dom  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
PS51293  SANT  
CDD cd00167  SANT  
Amino Acid Sequences WKTIAEAIPGRTNKACRKRWKHSLHPSIKKTPWEPEEDELLLQLNAQHPGRWALIANHISGRTDDACAKRYREALDPNLKKDDWTKEEDERLLEGYSRHGAAWGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.62
4 0.71
5 0.77
6 0.83
7 0.86
8 0.87
9 0.88
10 0.9
11 0.9
12 0.9
13 0.86
14 0.85
15 0.79
16 0.74
17 0.66
18 0.62
19 0.55
20 0.51
21 0.47
22 0.4
23 0.4
24 0.35
25 0.31
26 0.23
27 0.2
28 0.14
29 0.11
30 0.1
31 0.07
32 0.09
33 0.09
34 0.09
35 0.09
36 0.12
37 0.12
38 0.11
39 0.11
40 0.09
41 0.15
42 0.16
43 0.15
44 0.15
45 0.14
46 0.15
47 0.14
48 0.15
49 0.1
50 0.1
51 0.14
52 0.15
53 0.19
54 0.21
55 0.23
56 0.24
57 0.26
58 0.27
59 0.29
60 0.33
61 0.37
62 0.46
63 0.47
64 0.48
65 0.5
66 0.47
67 0.43
68 0.43
69 0.43
70 0.36
71 0.39
72 0.4
73 0.4
74 0.45
75 0.45
76 0.41
77 0.34
78 0.31
79 0.26
80 0.23
81 0.18
82 0.18
83 0.19
84 0.18
85 0.16
86 0.18