Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PNS1

Protein Details
Accession A0A0C3PNS1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-46GSLGWRTRSPPNRRGRSLKKLGAKRRLSWRRRQRSGRRDRGRESGWBasic
58-82ARMPIIKTRRRTKRRNSVVARKVPAHydrophilic
NLS Segment(s)
PositionSequence
8-75RSPPNRRGRSLKKLGAKRRLSWRRRQRSGRRDRGRESGWRRLRMEKSYLMARMPIIKTRRRTKRRNSV
Subcellular Location(s) nucl 16, mito_nucl 14.166, mito 10, cyto_nucl 9.666
Family & Domain DBs
Amino Acid Sequences GSLGWRTRSPPNRRGRSLKKLGAKRRLSWRRRQRSGRRDRGRESGWRRLRMEKSYLMARMPIIKTRRRTKRRNSVVARKVPALERVLPWTGMTGTSWRGKKGWRRSSSVPLRLGREVQRGLWLEISTTSKTQSRHGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.84
4 0.84
5 0.83
6 0.82
7 0.82
8 0.84
9 0.84
10 0.8
11 0.77
12 0.78
13 0.81
14 0.79
15 0.8
16 0.81
17 0.82
18 0.86
19 0.89
20 0.89
21 0.89
22 0.93
23 0.93
24 0.92
25 0.89
26 0.84
27 0.81
28 0.74
29 0.73
30 0.69
31 0.68
32 0.66
33 0.64
34 0.62
35 0.62
36 0.63
37 0.57
38 0.54
39 0.46
40 0.41
41 0.39
42 0.37
43 0.29
44 0.25
45 0.21
46 0.21
47 0.19
48 0.22
49 0.23
50 0.27
51 0.34
52 0.44
53 0.54
54 0.58
55 0.67
56 0.72
57 0.78
58 0.82
59 0.85
60 0.84
61 0.84
62 0.84
63 0.81
64 0.73
65 0.63
66 0.55
67 0.46
68 0.41
69 0.33
70 0.26
71 0.2
72 0.22
73 0.21
74 0.2
75 0.18
76 0.15
77 0.13
78 0.11
79 0.11
80 0.09
81 0.11
82 0.17
83 0.18
84 0.19
85 0.21
86 0.27
87 0.36
88 0.46
89 0.53
90 0.52
91 0.59
92 0.63
93 0.72
94 0.75
95 0.73
96 0.69
97 0.63
98 0.62
99 0.58
100 0.57
101 0.51
102 0.48
103 0.43
104 0.36
105 0.39
106 0.37
107 0.36
108 0.33
109 0.28
110 0.22
111 0.23
112 0.26
113 0.22
114 0.2
115 0.22
116 0.23
117 0.25