Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BLL7

Protein Details
Accession Q6BLL7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYDRVAENBasic
NLS Segment(s)
PositionSequence
9-21KIVKKHTKKFKRH
Subcellular Location(s) mito 15.5, mito_nucl 12.833, nucl 9, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG dha:DEHA2F12430g  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYDRVAENWRKQKGIDSCVRRRFRGTISQPNIGYGSNRKTRHMMPSGHKAFLVKNLKDLDVLLLHSKTYAAEISHNVSARNRVEIVAKAKKLGVKVTNPKGRVSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.92
11 0.89
12 0.88
13 0.82
14 0.71
15 0.65
16 0.65
17 0.62
18 0.61
19 0.61
20 0.55
21 0.5
22 0.5
23 0.54
24 0.5
25 0.49
26 0.48
27 0.49
28 0.55
29 0.64
30 0.68
31 0.61
32 0.58
33 0.54
34 0.49
35 0.51
36 0.49
37 0.5
38 0.51
39 0.54
40 0.51
41 0.48
42 0.45
43 0.34
44 0.28
45 0.21
46 0.22
47 0.25
48 0.26
49 0.26
50 0.29
51 0.31
52 0.36
53 0.38
54 0.38
55 0.35
56 0.44
57 0.45
58 0.43
59 0.41
60 0.35
61 0.29
62 0.33
63 0.36
64 0.25
65 0.27
66 0.28
67 0.28
68 0.28
69 0.28
70 0.2
71 0.13
72 0.14
73 0.12
74 0.11
75 0.1
76 0.1
77 0.1
78 0.08
79 0.09
80 0.09
81 0.07
82 0.09
83 0.11
84 0.15
85 0.18
86 0.18
87 0.18
88 0.19
89 0.24
90 0.23
91 0.24
92 0.21
93 0.19
94 0.22
95 0.26
96 0.33
97 0.35
98 0.35
99 0.33
100 0.35
101 0.37
102 0.36
103 0.38
104 0.37
105 0.39
106 0.48
107 0.57
108 0.63
109 0.62
110 0.62
111 0.58