Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PS15

Protein Details
Accession A0A0C3PS15    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
236-255SLLSKRKGSLRKKQRSGSSDHydrophilic
NLS Segment(s)
PositionSequence
240-254KRKGSLRKKQRSGSS
257-262SQKKKR
274-279KGGGHK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSVQYTGLEGRPKSEKAFMGIIPPPPPSTYPPPSAVPVPIPLPDERPGAPPRMETATSAATVLPPGGYPKTPLDSSTSVKIVPAVERVAAPASPSSTTRQRQASQGTVGAKRSTTLGRTLSRKSVQDPAGGGGEQGKGWVLVNVEPTRKASMDAAVAAMGAAAAANARVRNRSTSSSGPLNNAAAGMVTEGAMMESPVDAFSHRGGGGGHVRDNTVDTLDAPVDHHAGTEESGPISLLSKRKGSLRKKQRSGSSDDSQKKKRFLDLFSMGSKSKGGGHKKMSSKPTIRTGMMLAEERIGEGGEYEVTSPIPDDRLDERDDSRGAVDGVKESTWRRVGDPKTPTPVSKLTIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.34
4 0.38
5 0.34
6 0.35
7 0.36
8 0.37
9 0.33
10 0.33
11 0.3
12 0.28
13 0.3
14 0.3
15 0.35
16 0.37
17 0.4
18 0.42
19 0.43
20 0.44
21 0.44
22 0.4
23 0.33
24 0.3
25 0.27
26 0.25
27 0.25
28 0.23
29 0.25
30 0.25
31 0.26
32 0.24
33 0.29
34 0.29
35 0.32
36 0.32
37 0.29
38 0.29
39 0.32
40 0.31
41 0.26
42 0.27
43 0.24
44 0.23
45 0.22
46 0.19
47 0.13
48 0.13
49 0.12
50 0.08
51 0.06
52 0.09
53 0.11
54 0.11
55 0.14
56 0.17
57 0.21
58 0.21
59 0.22
60 0.25
61 0.27
62 0.3
63 0.31
64 0.29
65 0.24
66 0.24
67 0.25
68 0.2
69 0.18
70 0.17
71 0.14
72 0.14
73 0.14
74 0.14
75 0.14
76 0.12
77 0.11
78 0.1
79 0.1
80 0.11
81 0.13
82 0.16
83 0.24
84 0.27
85 0.32
86 0.37
87 0.37
88 0.42
89 0.45
90 0.44
91 0.38
92 0.4
93 0.38
94 0.35
95 0.35
96 0.3
97 0.25
98 0.21
99 0.21
100 0.19
101 0.16
102 0.18
103 0.21
104 0.25
105 0.29
106 0.32
107 0.36
108 0.38
109 0.38
110 0.37
111 0.39
112 0.36
113 0.34
114 0.32
115 0.27
116 0.24
117 0.22
118 0.19
119 0.13
120 0.12
121 0.09
122 0.08
123 0.07
124 0.06
125 0.06
126 0.07
127 0.06
128 0.07
129 0.12
130 0.14
131 0.15
132 0.16
133 0.17
134 0.18
135 0.17
136 0.17
137 0.13
138 0.12
139 0.12
140 0.11
141 0.1
142 0.08
143 0.08
144 0.06
145 0.05
146 0.03
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.03
153 0.04
154 0.05
155 0.07
156 0.08
157 0.11
158 0.14
159 0.17
160 0.21
161 0.22
162 0.25
163 0.28
164 0.28
165 0.27
166 0.25
167 0.22
168 0.18
169 0.15
170 0.12
171 0.07
172 0.06
173 0.04
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.02
183 0.03
184 0.03
185 0.03
186 0.04
187 0.05
188 0.05
189 0.07
190 0.07
191 0.07
192 0.07
193 0.1
194 0.14
195 0.14
196 0.15
197 0.14
198 0.14
199 0.14
200 0.15
201 0.13
202 0.09
203 0.08
204 0.07
205 0.08
206 0.08
207 0.08
208 0.07
209 0.08
210 0.08
211 0.08
212 0.07
213 0.07
214 0.07
215 0.08
216 0.08
217 0.07
218 0.07
219 0.07
220 0.07
221 0.06
222 0.07
223 0.11
224 0.13
225 0.15
226 0.17
227 0.19
228 0.26
229 0.36
230 0.43
231 0.5
232 0.58
233 0.67
234 0.73
235 0.79
236 0.81
237 0.76
238 0.75
239 0.72
240 0.69
241 0.68
242 0.68
243 0.69
244 0.69
245 0.7
246 0.67
247 0.62
248 0.62
249 0.57
250 0.52
251 0.54
252 0.5
253 0.49
254 0.46
255 0.46
256 0.38
257 0.34
258 0.3
259 0.22
260 0.22
261 0.26
262 0.3
263 0.35
264 0.42
265 0.5
266 0.57
267 0.64
268 0.64
269 0.66
270 0.65
271 0.63
272 0.65
273 0.62
274 0.55
275 0.49
276 0.44
277 0.38
278 0.35
279 0.31
280 0.22
281 0.18
282 0.17
283 0.15
284 0.14
285 0.11
286 0.08
287 0.06
288 0.06
289 0.06
290 0.06
291 0.07
292 0.07
293 0.07
294 0.07
295 0.08
296 0.08
297 0.09
298 0.1
299 0.13
300 0.16
301 0.2
302 0.23
303 0.25
304 0.26
305 0.29
306 0.29
307 0.26
308 0.23
309 0.22
310 0.19
311 0.18
312 0.17
313 0.15
314 0.17
315 0.16
316 0.19
317 0.19
318 0.26
319 0.29
320 0.29
321 0.31
322 0.38
323 0.43
324 0.49
325 0.55
326 0.55
327 0.59
328 0.61
329 0.58
330 0.55
331 0.55