Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3LGI3

Protein Details
Accession A0A0C3LGI3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-51GRPVSQCERCRERRKLRKLHVKCICDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences SCIQGHRSSSCSHVDRPLFEIRKKGRPVSQCERCRERRKLRKLHVKCICDER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.38
4 0.43
5 0.41
6 0.39
7 0.45
8 0.42
9 0.48
10 0.5
11 0.49
12 0.46
13 0.47
14 0.54
15 0.56
16 0.61
17 0.6
18 0.64
19 0.69
20 0.73
21 0.76
22 0.78
23 0.79
24 0.8
25 0.83
26 0.87
27 0.89
28 0.91
29 0.89
30 0.9
31 0.88
32 0.82