Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3L2C9

Protein Details
Accession A0A0C3L2C9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-92PSSHAPSEPPQKKKRRPTPTFTDSHydrophilic
NLS Segment(s)
PositionSequence
43-54KERPKPSASPAP
59-84SVKRRQPSPAPSSHAPSEPPQKKKRR
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025260  CHD1-like_C  
Pfam View protein in Pfam  
PF13907  DUF4208  
Amino Acid Sequences MPPANSTKPIPNAIHLVRRGDYLLGVLSEYEEKLRSIHMNIRKERPKPSASPAPSGTQSVKRRQPSPAPSSHAPSEPPQKKKRRPTPTFTDSESSDECPSMDESQTKEELRPVKKQLKRLKGSTETGTKEEKVALLKESLAQIGARIAAVVAEKNAKGEDGEKWRKHLWTFVTLFWPRKVKYAQLQIIHDKITQQKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.45
4 0.39
5 0.38
6 0.36
7 0.29
8 0.24
9 0.17
10 0.15
11 0.11
12 0.1
13 0.08
14 0.09
15 0.09
16 0.09
17 0.1
18 0.09
19 0.1
20 0.1
21 0.13
22 0.14
23 0.16
24 0.24
25 0.31
26 0.39
27 0.44
28 0.54
29 0.59
30 0.61
31 0.65
32 0.64
33 0.62
34 0.57
35 0.6
36 0.6
37 0.56
38 0.57
39 0.52
40 0.49
41 0.44
42 0.42
43 0.37
44 0.36
45 0.38
46 0.41
47 0.46
48 0.48
49 0.49
50 0.52
51 0.58
52 0.57
53 0.58
54 0.56
55 0.55
56 0.52
57 0.54
58 0.5
59 0.43
60 0.36
61 0.34
62 0.38
63 0.39
64 0.45
65 0.5
66 0.58
67 0.66
68 0.75
69 0.82
70 0.82
71 0.82
72 0.81
73 0.81
74 0.77
75 0.71
76 0.63
77 0.55
78 0.45
79 0.41
80 0.34
81 0.27
82 0.2
83 0.17
84 0.14
85 0.12
86 0.12
87 0.11
88 0.1
89 0.1
90 0.11
91 0.13
92 0.16
93 0.15
94 0.14
95 0.17
96 0.24
97 0.25
98 0.3
99 0.35
100 0.42
101 0.46
102 0.55
103 0.6
104 0.63
105 0.66
106 0.64
107 0.65
108 0.61
109 0.61
110 0.56
111 0.54
112 0.46
113 0.43
114 0.41
115 0.34
116 0.28
117 0.25
118 0.22
119 0.18
120 0.16
121 0.15
122 0.13
123 0.13
124 0.13
125 0.14
126 0.12
127 0.1
128 0.09
129 0.08
130 0.08
131 0.08
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.08
140 0.09
141 0.1
142 0.1
143 0.1
144 0.1
145 0.11
146 0.17
147 0.25
148 0.35
149 0.36
150 0.41
151 0.44
152 0.48
153 0.47
154 0.47
155 0.42
156 0.41
157 0.42
158 0.39
159 0.45
160 0.46
161 0.48
162 0.48
163 0.5
164 0.42
165 0.46
166 0.47
167 0.45
168 0.49
169 0.56
170 0.58
171 0.57
172 0.62
173 0.62
174 0.62
175 0.56
176 0.48
177 0.42