Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q0E8

Protein Details
Accession A0A0C3Q0E8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-40KVPWRLSATRKARQRQRLKDVDQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRASPVSASGLLWKVPWRLSATRKARQRQRLKDVDQVIETIRQSGVQCESLTRALALPKEHEMPARDKYTVFNRRSKGYRKGIHKVPKWTRLTLRENPLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.18
5 0.18
6 0.18
7 0.21
8 0.22
9 0.27
10 0.32
11 0.42
12 0.47
13 0.53
14 0.6
15 0.67
16 0.71
17 0.75
18 0.8
19 0.8
20 0.81
21 0.82
22 0.78
23 0.77
24 0.71
25 0.63
26 0.53
27 0.44
28 0.34
29 0.28
30 0.23
31 0.16
32 0.12
33 0.11
34 0.1
35 0.11
36 0.12
37 0.11
38 0.11
39 0.1
40 0.12
41 0.11
42 0.11
43 0.1
44 0.09
45 0.09
46 0.11
47 0.11
48 0.11
49 0.13
50 0.15
51 0.15
52 0.17
53 0.18
54 0.21
55 0.25
56 0.26
57 0.24
58 0.23
59 0.26
60 0.34
61 0.41
62 0.41
63 0.43
64 0.44
65 0.5
66 0.56
67 0.6
68 0.6
69 0.61
70 0.64
71 0.66
72 0.71
73 0.75
74 0.78
75 0.77
76 0.78
77 0.78
78 0.79
79 0.76
80 0.74
81 0.73
82 0.72
83 0.73
84 0.71
85 0.7