Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QRK5

Protein Details
Accession A0A0C3QRK5   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-85IFKNEPAHGERKKRRRRKQRSRYKYSSRHEBasic
NLS Segment(s)
PositionSequence
64-79GERKKRRRRKQRSRYK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MTCSDDSKRLWPRGKNSQEVRVRYPPPLRLQVQPRTSPRPLRGPLEAKSVSDAFCIFKNEPAHGERKKRRRRKQRSRYKYSSRHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.7
4 0.71
5 0.72
6 0.69
7 0.68
8 0.65
9 0.6
10 0.57
11 0.56
12 0.52
13 0.5
14 0.53
15 0.48
16 0.47
17 0.52
18 0.54
19 0.54
20 0.55
21 0.54
22 0.54
23 0.55
24 0.54
25 0.5
26 0.5
27 0.48
28 0.44
29 0.44
30 0.41
31 0.39
32 0.4
33 0.37
34 0.29
35 0.28
36 0.26
37 0.21
38 0.17
39 0.16
40 0.1
41 0.11
42 0.15
43 0.13
44 0.18
45 0.2
46 0.2
47 0.23
48 0.25
49 0.31
50 0.34
51 0.45
52 0.49
53 0.59
54 0.69
55 0.76
56 0.85
57 0.88
58 0.93
59 0.94
60 0.95
61 0.96
62 0.96
63 0.96
64 0.95
65 0.95