Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E5E8

Protein Details
Accession E9E5E8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-69HTVQIRPRGRGRPRKDWLQLPHydrophilic
NLS Segment(s)
PositionSequence
57-61GRGRP
Subcellular Location(s) mito 10, extr 5, cyto 4.5, cyto_nucl 3.5, plas 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG maw:MAC_05096  -  
CDD cd00067  GAL4  
Amino Acid Sequences MTRVMSQLWFRCDETRPTCSACSKFSIPCSFSAPCTAATCDSAGNHVSHTVQIRPRGRGRPRKDWLQLPPDPRVPDSRPTYRDDSPLNLGEAELLLHFTQVTAQSLAGDTDPKDQMVQFWARNVPRIGLSNPFVLNLMYATAAYHLAELSCNLDKKRHYKSMAESHWTKGTAVLSTVMGILDDSNCGAAYIGATLLCYCSFAAGPSGPGDLLVCDIDGKNRWRNLVSGVRLIRESFPEDILFAGLMKPLGHSEPRETKRGATAACAARGLPRISWHDAMASMRKLAERQDGPYALVCVQSLDELALIYEGVYGDESGERNVSEDRQFVLSWLYRLDSDFVEAVRCQDTVSLLVLAYFAVLLATMEGEWWLRGWAQHLITSINDIVGPTAIQWPRNQVLRQLHLTQPEFVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.46
4 0.46
5 0.49
6 0.51
7 0.5
8 0.44
9 0.45
10 0.44
11 0.45
12 0.49
13 0.52
14 0.46
15 0.45
16 0.47
17 0.42
18 0.39
19 0.39
20 0.33
21 0.27
22 0.28
23 0.28
24 0.24
25 0.24
26 0.23
27 0.2
28 0.18
29 0.19
30 0.18
31 0.16
32 0.15
33 0.15
34 0.15
35 0.17
36 0.19
37 0.23
38 0.26
39 0.34
40 0.39
41 0.45
42 0.52
43 0.59
44 0.67
45 0.71
46 0.75
47 0.77
48 0.79
49 0.82
50 0.81
51 0.79
52 0.78
53 0.76
54 0.74
55 0.68
56 0.67
57 0.63
58 0.58
59 0.52
60 0.5
61 0.44
62 0.46
63 0.49
64 0.51
65 0.49
66 0.52
67 0.56
68 0.52
69 0.53
70 0.47
71 0.44
72 0.4
73 0.39
74 0.34
75 0.28
76 0.25
77 0.2
78 0.17
79 0.13
80 0.07
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.08
88 0.1
89 0.09
90 0.09
91 0.1
92 0.1
93 0.11
94 0.09
95 0.1
96 0.09
97 0.13
98 0.14
99 0.14
100 0.14
101 0.14
102 0.14
103 0.18
104 0.22
105 0.17
106 0.2
107 0.26
108 0.26
109 0.3
110 0.3
111 0.26
112 0.23
113 0.26
114 0.24
115 0.23
116 0.24
117 0.23
118 0.22
119 0.21
120 0.19
121 0.16
122 0.15
123 0.1
124 0.08
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.08
137 0.1
138 0.12
139 0.13
140 0.17
141 0.21
142 0.28
143 0.36
144 0.4
145 0.41
146 0.44
147 0.51
148 0.58
149 0.58
150 0.57
151 0.51
152 0.46
153 0.45
154 0.41
155 0.33
156 0.25
157 0.21
158 0.15
159 0.14
160 0.12
161 0.09
162 0.09
163 0.09
164 0.06
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.03
171 0.03
172 0.03
173 0.04
174 0.04
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.05
189 0.06
190 0.06
191 0.06
192 0.06
193 0.07
194 0.06
195 0.06
196 0.06
197 0.04
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.06
204 0.1
205 0.14
206 0.18
207 0.19
208 0.21
209 0.21
210 0.22
211 0.27
212 0.3
213 0.28
214 0.29
215 0.29
216 0.28
217 0.28
218 0.28
219 0.23
220 0.18
221 0.18
222 0.13
223 0.13
224 0.12
225 0.12
226 0.11
227 0.1
228 0.08
229 0.06
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.06
236 0.07
237 0.09
238 0.1
239 0.16
240 0.26
241 0.29
242 0.33
243 0.33
244 0.32
245 0.34
246 0.37
247 0.31
248 0.24
249 0.28
250 0.26
251 0.26
252 0.25
253 0.21
254 0.2
255 0.23
256 0.22
257 0.15
258 0.17
259 0.21
260 0.25
261 0.26
262 0.24
263 0.21
264 0.21
265 0.23
266 0.23
267 0.19
268 0.16
269 0.15
270 0.16
271 0.16
272 0.18
273 0.23
274 0.21
275 0.23
276 0.28
277 0.28
278 0.28
279 0.28
280 0.27
281 0.19
282 0.18
283 0.15
284 0.1
285 0.09
286 0.08
287 0.07
288 0.06
289 0.05
290 0.05
291 0.05
292 0.04
293 0.04
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.05
301 0.07
302 0.07
303 0.08
304 0.08
305 0.08
306 0.09
307 0.11
308 0.14
309 0.14
310 0.15
311 0.16
312 0.18
313 0.18
314 0.17
315 0.21
316 0.19
317 0.18
318 0.18
319 0.17
320 0.15
321 0.17
322 0.18
323 0.13
324 0.14
325 0.14
326 0.13
327 0.14
328 0.14
329 0.15
330 0.14
331 0.14
332 0.12
333 0.12
334 0.13
335 0.12
336 0.13
337 0.12
338 0.1
339 0.1
340 0.1
341 0.09
342 0.07
343 0.06
344 0.04
345 0.03
346 0.03
347 0.03
348 0.03
349 0.04
350 0.03
351 0.04
352 0.05
353 0.05
354 0.05
355 0.06
356 0.07
357 0.07
358 0.08
359 0.11
360 0.17
361 0.18
362 0.21
363 0.22
364 0.22
365 0.22
366 0.25
367 0.22
368 0.16
369 0.15
370 0.12
371 0.12
372 0.1
373 0.1
374 0.08
375 0.16
376 0.18
377 0.2
378 0.21
379 0.28
380 0.33
381 0.4
382 0.41
383 0.41
384 0.48
385 0.53
386 0.58
387 0.56
388 0.55
389 0.56
390 0.57