Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q7S6

Protein Details
Accession A0A0C3Q7S6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-96ITGATLKMKRHRRHDRIGSRRHBasic
NLS Segment(s)
PositionSequence
81-96KMKRHRRHDRIGSRRH
Subcellular Location(s) cyto 12, mito 10, cyto_nucl 8, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005089  CBM_fam19  
Gene Ontology GO:0008061  F:chitin binding  
GO:0006032  P:chitin catabolic process  
Pfam View protein in Pfam  
PF03427  CBM_19  
Amino Acid Sequences AIALNHKYQSIVAGTSCTNYDIGCIGDAFAQCVWGTWVATKCPVGTVCAALPNVGAPGTSIACTTPADRDMRIAITGATLKMKRHRRHDRIGSRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.13
5 0.11
6 0.1
7 0.1
8 0.09
9 0.09
10 0.08
11 0.08
12 0.07
13 0.09
14 0.09
15 0.1
16 0.08
17 0.09
18 0.08
19 0.08
20 0.09
21 0.07
22 0.07
23 0.09
24 0.11
25 0.11
26 0.13
27 0.13
28 0.12
29 0.13
30 0.13
31 0.11
32 0.1
33 0.11
34 0.09
35 0.11
36 0.11
37 0.09
38 0.09
39 0.07
40 0.07
41 0.06
42 0.05
43 0.03
44 0.05
45 0.05
46 0.06
47 0.06
48 0.05
49 0.07
50 0.08
51 0.08
52 0.09
53 0.12
54 0.14
55 0.14
56 0.15
57 0.15
58 0.16
59 0.16
60 0.14
61 0.11
62 0.11
63 0.12
64 0.11
65 0.15
66 0.16
67 0.2
68 0.29
69 0.39
70 0.45
71 0.55
72 0.66
73 0.69
74 0.78
75 0.86
76 0.88