Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QLQ7

Protein Details
Accession A0A0C3QLQ7   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
129-152DIGVKRVKKWVKQWYRAHRKVENSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8, cyto_nucl 7.333, cyto_pero 6.333, extr 6, nucl 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR008758  Peptidase_S28  
Gene Ontology GO:0008236  F:serine-type peptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF05577  Peptidase_S28  
Amino Acid Sequences MVCNEFGFFQDGDPGNYSSIVSSLVTAGYNPRQCNHMFPNADGSIGSFYPDTDDVNSDHGGGWNLRARNLFVVNGQFDPWRSASLSSRYAPKFRNTPHQRVEVVRGGHHCWDWNLYGARYNRDVKRVVDIGVKRVKKWVKQWYRAHRKVENSMPKGKVNYWAGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.2
4 0.2
5 0.13
6 0.12
7 0.11
8 0.09
9 0.08
10 0.07
11 0.08
12 0.08
13 0.08
14 0.11
15 0.17
16 0.22
17 0.23
18 0.23
19 0.26
20 0.27
21 0.33
22 0.34
23 0.36
24 0.33
25 0.33
26 0.39
27 0.36
28 0.35
29 0.28
30 0.24
31 0.17
32 0.15
33 0.15
34 0.08
35 0.08
36 0.1
37 0.1
38 0.1
39 0.09
40 0.1
41 0.1
42 0.13
43 0.13
44 0.11
45 0.11
46 0.11
47 0.11
48 0.1
49 0.12
50 0.13
51 0.14
52 0.15
53 0.15
54 0.15
55 0.16
56 0.17
57 0.15
58 0.13
59 0.14
60 0.14
61 0.14
62 0.14
63 0.12
64 0.11
65 0.13
66 0.11
67 0.1
68 0.09
69 0.11
70 0.12
71 0.16
72 0.19
73 0.18
74 0.24
75 0.25
76 0.28
77 0.29
78 0.31
79 0.33
80 0.32
81 0.43
82 0.43
83 0.5
84 0.51
85 0.54
86 0.52
87 0.47
88 0.5
89 0.44
90 0.38
91 0.32
92 0.3
93 0.27
94 0.26
95 0.25
96 0.2
97 0.16
98 0.17
99 0.15
100 0.17
101 0.18
102 0.16
103 0.22
104 0.23
105 0.26
106 0.28
107 0.34
108 0.33
109 0.35
110 0.38
111 0.33
112 0.37
113 0.35
114 0.33
115 0.34
116 0.32
117 0.35
118 0.41
119 0.41
120 0.35
121 0.43
122 0.47
123 0.46
124 0.55
125 0.58
126 0.6
127 0.69
128 0.79
129 0.82
130 0.87
131 0.88
132 0.87
133 0.82
134 0.79
135 0.77
136 0.77
137 0.77
138 0.71
139 0.72
140 0.68
141 0.65
142 0.62
143 0.55
144 0.54
145 0.47