Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9EI68

Protein Details
Accession E9EI68   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-82SSAASNKDKKDKKDSKKVKLPTVVLHydrophilic
NLS Segment(s)
PositionSequence
65-74DKKDKKDSKK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
KEGG maw:MAC_09566  -  
Amino Acid Sequences MNAANIQAQQALNAYGPVSSPHIFDRASSKKVFADMLGSRRPSPASTPAESRRASADSSAASNKDKKDKKDSKKVKLPTVVLPCFRFVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.08
4 0.09
5 0.12
6 0.12
7 0.13
8 0.14
9 0.16
10 0.16
11 0.17
12 0.24
13 0.25
14 0.29
15 0.28
16 0.28
17 0.26
18 0.27
19 0.27
20 0.18
21 0.18
22 0.17
23 0.21
24 0.23
25 0.24
26 0.23
27 0.23
28 0.24
29 0.19
30 0.19
31 0.22
32 0.23
33 0.23
34 0.28
35 0.31
36 0.37
37 0.36
38 0.34
39 0.29
40 0.26
41 0.24
42 0.2
43 0.18
44 0.12
45 0.15
46 0.16
47 0.15
48 0.16
49 0.2
50 0.23
51 0.31
52 0.36
53 0.4
54 0.49
55 0.58
56 0.66
57 0.73
58 0.8
59 0.81
60 0.85
61 0.87
62 0.85
63 0.83
64 0.76
65 0.74
66 0.73
67 0.68
68 0.64
69 0.58