Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QKE4

Protein Details
Accession A0A0C3QKE4   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-99DEISNPKKGKARPKKKPNQNRRRPNDPSAEQHydrophilic
NLS Segment(s)
PositionSequence
74-92PKKGKARPKKKPNQNRRRP
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MQAYTSPEAGSDGTPAMGPIINPIRLSSYSGISVTTKKGGDAWTGTQPGQQRGKSATKPRISEPAEPSDEISNPKKGKARPKKKPNQNRRRPNDPSAEQSMPKPSTPSIPVPARSEAPGTRQARRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.07
6 0.12
7 0.16
8 0.17
9 0.17
10 0.18
11 0.2
12 0.21
13 0.24
14 0.2
15 0.17
16 0.17
17 0.17
18 0.18
19 0.16
20 0.17
21 0.16
22 0.17
23 0.15
24 0.14
25 0.16
26 0.16
27 0.17
28 0.17
29 0.18
30 0.2
31 0.21
32 0.21
33 0.22
34 0.23
35 0.27
36 0.3
37 0.28
38 0.25
39 0.28
40 0.34
41 0.38
42 0.44
43 0.46
44 0.46
45 0.47
46 0.47
47 0.51
48 0.49
49 0.49
50 0.44
51 0.41
52 0.37
53 0.35
54 0.34
55 0.26
56 0.24
57 0.22
58 0.21
59 0.22
60 0.21
61 0.24
62 0.29
63 0.32
64 0.43
65 0.5
66 0.59
67 0.63
68 0.74
69 0.82
70 0.87
71 0.94
72 0.94
73 0.94
74 0.94
75 0.94
76 0.91
77 0.9
78 0.86
79 0.83
80 0.81
81 0.73
82 0.69
83 0.65
84 0.6
85 0.51
86 0.46
87 0.47
88 0.39
89 0.36
90 0.32
91 0.26
92 0.28
93 0.31
94 0.34
95 0.34
96 0.37
97 0.41
98 0.42
99 0.45
100 0.41
101 0.39
102 0.39
103 0.33
104 0.32
105 0.38
106 0.38