Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3LVE4

Protein Details
Accession A0A0C3LVE4    Localization Confidence High Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPHKRLKQSARIERRNKLGFDHydrophilic
216-238KAIERYRELKRLKTQQKTRLDLVHydrophilic
NLS Segment(s)
PositionSequence
14-15RR
53-70KRKREEEEEGIRPPKRSR
115-126SKGGGGKKRKAA
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
Amino Acid Sequences MPHKRLKQSARIERRNKLGFDRPPTKEKGDSMSKKMAWITNAEEMREQLKQLKRKREEEEEGIRPPKRSRGSAGDGEAGQPTAVKIKPGESMRDFNRRVEEEFKWKMQGVYKQASKGGGGKKRKAAKQDAQDNPTGSSITATTSAEAKPSTGKGKTEFERRVDRRSVNDVAEAPPTLTALPRGAAAAAGKSGKASAESQLPVSAVQKRMMEEEREKAIERYRELKRLKTQQKTRLDLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.73
4 0.7
5 0.68
6 0.66
7 0.68
8 0.7
9 0.66
10 0.65
11 0.67
12 0.64
13 0.59
14 0.53
15 0.51
16 0.53
17 0.54
18 0.54
19 0.57
20 0.53
21 0.5
22 0.51
23 0.47
24 0.37
25 0.34
26 0.32
27 0.32
28 0.32
29 0.31
30 0.28
31 0.26
32 0.27
33 0.25
34 0.21
35 0.21
36 0.27
37 0.35
38 0.43
39 0.52
40 0.57
41 0.64
42 0.7
43 0.71
44 0.71
45 0.7
46 0.7
47 0.64
48 0.62
49 0.61
50 0.56
51 0.49
52 0.45
53 0.45
54 0.42
55 0.39
56 0.39
57 0.41
58 0.45
59 0.46
60 0.46
61 0.4
62 0.36
63 0.33
64 0.28
65 0.2
66 0.14
67 0.1
68 0.07
69 0.09
70 0.09
71 0.09
72 0.1
73 0.11
74 0.17
75 0.19
76 0.24
77 0.24
78 0.29
79 0.32
80 0.41
81 0.41
82 0.37
83 0.4
84 0.37
85 0.36
86 0.35
87 0.34
88 0.33
89 0.35
90 0.33
91 0.3
92 0.29
93 0.28
94 0.27
95 0.3
96 0.27
97 0.3
98 0.3
99 0.3
100 0.3
101 0.29
102 0.26
103 0.26
104 0.27
105 0.29
106 0.32
107 0.35
108 0.41
109 0.47
110 0.5
111 0.51
112 0.52
113 0.52
114 0.55
115 0.62
116 0.61
117 0.57
118 0.56
119 0.5
120 0.43
121 0.36
122 0.27
123 0.17
124 0.12
125 0.09
126 0.08
127 0.08
128 0.07
129 0.07
130 0.09
131 0.09
132 0.09
133 0.09
134 0.09
135 0.09
136 0.12
137 0.16
138 0.16
139 0.18
140 0.21
141 0.27
142 0.32
143 0.39
144 0.42
145 0.42
146 0.51
147 0.52
148 0.55
149 0.54
150 0.52
151 0.48
152 0.5
153 0.48
154 0.38
155 0.38
156 0.33
157 0.29
158 0.27
159 0.23
160 0.16
161 0.13
162 0.12
163 0.1
164 0.09
165 0.09
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.07
174 0.09
175 0.09
176 0.08
177 0.08
178 0.09
179 0.08
180 0.1
181 0.11
182 0.11
183 0.16
184 0.17
185 0.18
186 0.18
187 0.19
188 0.17
189 0.19
190 0.23
191 0.2
192 0.23
193 0.24
194 0.24
195 0.29
196 0.32
197 0.36
198 0.35
199 0.38
200 0.39
201 0.4
202 0.41
203 0.38
204 0.42
205 0.41
206 0.41
207 0.44
208 0.45
209 0.52
210 0.55
211 0.61
212 0.63
213 0.68
214 0.74
215 0.77
216 0.8
217 0.81
218 0.87