Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3L9F7

Protein Details
Accession A0A0C3L9F7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-38LALRKLAKKLQWRRCPQCRIVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031127  E3_UB_ligase_RBR  
Gene Ontology GO:0004842  F:ubiquitin-protein transferase activity  
GO:0016567  P:protein ubiquitination  
CDD cd22584  Rcat_RBR_unk  
Amino Acid Sequences MSCSKWQASAKSIGGSDLALRKLAKKLQWRRCPQCRIVVERNEGCKHMTCRCGHQFCFLYVSGYAGPTRGPSCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.2
4 0.17
5 0.16
6 0.15
7 0.15
8 0.17
9 0.21
10 0.24
11 0.28
12 0.34
13 0.44
14 0.53
15 0.63
16 0.71
17 0.76
18 0.81
19 0.82
20 0.75
21 0.74
22 0.67
23 0.65
24 0.62
25 0.58
26 0.54
27 0.51
28 0.53
29 0.45
30 0.41
31 0.35
32 0.32
33 0.3
34 0.3
35 0.32
36 0.29
37 0.36
38 0.44
39 0.49
40 0.46
41 0.5
42 0.47
43 0.42
44 0.44
45 0.36
46 0.29
47 0.23
48 0.24
49 0.17
50 0.16
51 0.15
52 0.11
53 0.12
54 0.13