Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3KKK2

Protein Details
Accession A0A0C3KKK2    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTKKRRNGGRNKKNRGHVNPLRCSNCHydrophilic
81-105SHVVRVRSRQGRKNRLPPPRIRYKDBasic
NLS Segment(s)
PositionSequence
3-15KKRRNGGRNKKNR
87-108RSRQGRKNRLPPPRIRYKDGKK
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTKKRRNGGRNKKNRGHVNPLRCSNCARCVPKDKAIKRFTVRNMVESAATRDISEASIFEQYNIPKLHLKVVYCVSCAIHSHVVRVRSRQGRKNRLPPPRIRYKDGKKVNPAVAAAGGQGAAKPAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.86
4 0.84
5 0.82
6 0.81
7 0.81
8 0.75
9 0.66
10 0.63
11 0.57
12 0.56
13 0.55
14 0.51
15 0.5
16 0.54
17 0.59
18 0.62
19 0.67
20 0.66
21 0.67
22 0.66
23 0.66
24 0.62
25 0.64
26 0.6
27 0.6
28 0.54
29 0.47
30 0.44
31 0.37
32 0.34
33 0.27
34 0.26
35 0.18
36 0.17
37 0.14
38 0.13
39 0.12
40 0.11
41 0.1
42 0.07
43 0.06
44 0.09
45 0.09
46 0.1
47 0.12
48 0.11
49 0.16
50 0.16
51 0.17
52 0.16
53 0.17
54 0.21
55 0.21
56 0.21
57 0.19
58 0.23
59 0.23
60 0.21
61 0.21
62 0.17
63 0.15
64 0.16
65 0.16
66 0.18
67 0.17
68 0.2
69 0.23
70 0.27
71 0.28
72 0.31
73 0.36
74 0.39
75 0.46
76 0.51
77 0.59
78 0.65
79 0.73
80 0.8
81 0.81
82 0.82
83 0.83
84 0.84
85 0.82
86 0.82
87 0.79
88 0.75
89 0.76
90 0.76
91 0.77
92 0.78
93 0.78
94 0.75
95 0.78
96 0.76
97 0.69
98 0.59
99 0.5
100 0.41
101 0.33
102 0.24
103 0.17
104 0.12
105 0.08
106 0.08
107 0.08