Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q2E8

Protein Details
Accession A0A0C3Q2E8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-41KVPWRLSAPRKARQRQRLRDVDEVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRASPVSASGLLWKVPWRLSAPRKARQRQRLRDVDEVIETVRQSGVQCESLTRALALPKEYEMPAKDKYTVFNRRSKGYRKGIHKVPKWTRLTLRENPLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.18
5 0.18
6 0.18
7 0.21
8 0.21
9 0.29
10 0.36
11 0.45
12 0.5
13 0.56
14 0.66
15 0.72
16 0.78
17 0.8
18 0.83
19 0.83
20 0.85
21 0.86
22 0.81
23 0.78
24 0.7
25 0.61
26 0.5
27 0.41
28 0.31
29 0.23
30 0.17
31 0.11
32 0.08
33 0.07
34 0.07
35 0.08
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.11
42 0.11
43 0.1
44 0.09
45 0.09
46 0.1
47 0.11
48 0.09
49 0.1
50 0.11
51 0.12
52 0.13
53 0.14
54 0.16
55 0.18
56 0.19
57 0.22
58 0.2
59 0.25
60 0.31
61 0.4
62 0.41
63 0.45
64 0.46
65 0.5
66 0.57
67 0.6
68 0.61
69 0.61
70 0.64
71 0.66
72 0.71
73 0.75
74 0.78
75 0.77
76 0.78
77 0.78
78 0.79
79 0.76
80 0.74
81 0.73
82 0.72
83 0.73
84 0.71
85 0.7