Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PRA4

Protein Details
Accession A0A0C3PRA4    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-123SLAKTFENRAKRKNKKPDERPAWTNVHydrophilic
NLS Segment(s)
PositionSequence
106-114RAKRKNKKP
Subcellular Location(s) nucl 17, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039119  ABT1/Esf2  
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences ARRKHTNSKVTRANEGWIEFTDKKVARSVADMLNGQPVGGKRGDRHKDDVWTMKYLPKFKWNMLTDQLRHDKAVRTARLRIELSRSTREQEEYLKQVSLAKTFENRAKRKNKKPDERPAWTNVFEGPQKAPKPAAASDAPRDSETVQREGQLKDVLGKIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.48
3 0.4
4 0.32
5 0.36
6 0.28
7 0.28
8 0.32
9 0.29
10 0.29
11 0.31
12 0.31
13 0.25
14 0.28
15 0.3
16 0.25
17 0.27
18 0.26
19 0.22
20 0.25
21 0.23
22 0.2
23 0.18
24 0.15
25 0.15
26 0.16
27 0.17
28 0.17
29 0.27
30 0.34
31 0.35
32 0.41
33 0.42
34 0.45
35 0.48
36 0.52
37 0.45
38 0.42
39 0.39
40 0.37
41 0.38
42 0.37
43 0.34
44 0.34
45 0.34
46 0.32
47 0.41
48 0.38
49 0.38
50 0.4
51 0.44
52 0.37
53 0.42
54 0.45
55 0.36
56 0.36
57 0.33
58 0.3
59 0.3
60 0.36
61 0.34
62 0.32
63 0.35
64 0.36
65 0.39
66 0.37
67 0.32
68 0.29
69 0.3
70 0.31
71 0.31
72 0.3
73 0.27
74 0.28
75 0.28
76 0.24
77 0.24
78 0.23
79 0.22
80 0.22
81 0.2
82 0.19
83 0.21
84 0.21
85 0.19
86 0.16
87 0.14
88 0.16
89 0.19
90 0.24
91 0.3
92 0.34
93 0.41
94 0.51
95 0.6
96 0.68
97 0.76
98 0.82
99 0.83
100 0.89
101 0.91
102 0.9
103 0.87
104 0.81
105 0.77
106 0.71
107 0.61
108 0.51
109 0.41
110 0.36
111 0.29
112 0.27
113 0.24
114 0.27
115 0.27
116 0.28
117 0.28
118 0.27
119 0.3
120 0.29
121 0.31
122 0.28
123 0.31
124 0.35
125 0.38
126 0.37
127 0.33
128 0.34
129 0.3
130 0.32
131 0.32
132 0.3
133 0.27
134 0.29
135 0.32
136 0.32
137 0.34
138 0.31
139 0.27
140 0.27