Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3L541

Protein Details
Accession A0A0C3L541    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-30APAAGASDEKKKRKRVRKETYSSYIYKHydrophilic
NLS Segment(s)
PositionSequence
13-21KKKRKRVRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences KTAAPAAGASDEKKKRKRVRKETYSSYIYKVLKQVHPDTGISNKAMAILNSFVNDIFERIAEEASRLAQYSKKTTISSREIQTAVRLILPGELSKHAISEGTKSVTKFSAGASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.74
4 0.83
5 0.85
6 0.88
7 0.9
8 0.91
9 0.9
10 0.87
11 0.82
12 0.73
13 0.64
14 0.6
15 0.5
16 0.43
17 0.4
18 0.38
19 0.35
20 0.39
21 0.39
22 0.36
23 0.37
24 0.35
25 0.32
26 0.29
27 0.28
28 0.22
29 0.19
30 0.15
31 0.14
32 0.14
33 0.12
34 0.1
35 0.09
36 0.09
37 0.09
38 0.09
39 0.07
40 0.08
41 0.08
42 0.07
43 0.06
44 0.05
45 0.05
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.07
55 0.09
56 0.12
57 0.16
58 0.19
59 0.21
60 0.22
61 0.25
62 0.31
63 0.35
64 0.38
65 0.36
66 0.36
67 0.35
68 0.34
69 0.33
70 0.28
71 0.22
72 0.17
73 0.15
74 0.11
75 0.12
76 0.12
77 0.11
78 0.11
79 0.12
80 0.14
81 0.14
82 0.14
83 0.13
84 0.14
85 0.14
86 0.16
87 0.18
88 0.2
89 0.22
90 0.22
91 0.25
92 0.24
93 0.25
94 0.22