Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3M2K7

Protein Details
Accession A0A0C3M2K7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKAPSGSKRKPRRHNPVRVPDSHLGBasic
NLS Segment(s)
PositionSequence
7-15GSKRKPRRH
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR000225  Armadillo  
PROSITE View protein in PROSITE  
PS50176  ARM_REPEAT  
Amino Acid Sequences MGKAPSGSKRKPRRHNPVRVPDSHLGHGVKLAEQTSSKGGQVIPVLDKLDSPEVEDRRWACAAVSSLIQNDASTRRLLQAKGVVDKLVTRLSDTDEDVIAEATGSLRQLSFVLALQRPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.93
4 0.94
5 0.91
6 0.83
7 0.8
8 0.75
9 0.69
10 0.59
11 0.53
12 0.42
13 0.35
14 0.33
15 0.25
16 0.19
17 0.17
18 0.15
19 0.12
20 0.11
21 0.13
22 0.14
23 0.14
24 0.13
25 0.13
26 0.13
27 0.13
28 0.14
29 0.14
30 0.12
31 0.13
32 0.13
33 0.12
34 0.12
35 0.11
36 0.13
37 0.11
38 0.12
39 0.16
40 0.17
41 0.17
42 0.2
43 0.19
44 0.2
45 0.2
46 0.18
47 0.12
48 0.13
49 0.13
50 0.11
51 0.11
52 0.09
53 0.09
54 0.09
55 0.09
56 0.07
57 0.08
58 0.09
59 0.09
60 0.09
61 0.1
62 0.13
63 0.16
64 0.16
65 0.18
66 0.21
67 0.23
68 0.26
69 0.26
70 0.23
71 0.2
72 0.21
73 0.2
74 0.18
75 0.15
76 0.12
77 0.13
78 0.16
79 0.18
80 0.19
81 0.18
82 0.15
83 0.15
84 0.14
85 0.13
86 0.09
87 0.07
88 0.06
89 0.05
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.09
98 0.1
99 0.16
100 0.17