Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DTW6

Protein Details
Accession E9DTW6   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
16-35TPARSGKQWHEQKKAFRPTKHydrophilic
69-115KEKIEKIREKRAKKEEKERYEKMAETMHRKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
32-36RPTKG
39-111TFEKRAKERAAMAQMKAKEKEMKEEKEAMRKEKIEKIREKRAKKEEKERYEKMAETMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG maw:MAC_01064  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MLLWQSREEERLWTLTPARSGKQWHEQKKAFRPTKGLTTFEKRAKERAAMAQMKAKEKEMKEEKEAMRKEKIEKIREKRAKKEEKERYEKMAETMHRKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.32
4 0.32
5 0.31
6 0.32
7 0.35
8 0.37
9 0.44
10 0.51
11 0.54
12 0.6
13 0.65
14 0.7
15 0.75
16 0.8
17 0.76
18 0.69
19 0.66
20 0.6
21 0.64
22 0.59
23 0.52
24 0.47
25 0.48
26 0.52
27 0.51
28 0.54
29 0.46
30 0.46
31 0.45
32 0.42
33 0.37
34 0.36
35 0.39
36 0.35
37 0.34
38 0.34
39 0.35
40 0.36
41 0.34
42 0.31
43 0.27
44 0.25
45 0.33
46 0.35
47 0.35
48 0.35
49 0.41
50 0.41
51 0.45
52 0.47
53 0.42
54 0.4
55 0.39
56 0.4
57 0.41
58 0.47
59 0.47
60 0.54
61 0.58
62 0.64
63 0.71
64 0.73
65 0.75
66 0.78
67 0.8
68 0.78
69 0.81
70 0.81
71 0.82
72 0.85
73 0.79
74 0.75
75 0.69
76 0.62
77 0.53
78 0.5
79 0.45
80 0.45
81 0.49
82 0.51
83 0.53
84 0.54
85 0.59
86 0.62
87 0.68
88 0.69
89 0.73
90 0.76
91 0.79
92 0.89
93 0.92
94 0.93
95 0.93