Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QW93

Protein Details
Accession A0A0C3QW93   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MLPSIRIEKPAPKRQRTKKSKVAEDDPAFHydrophilic
NLS Segment(s)
PositionSequence
9-21KPAPKRQRTKKSK
52-58RRRGKGG
Subcellular Location(s) nucl 19.5, mito_nucl 13.166, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
PROSITE View protein in PROSITE  
PS50181  FBOX  
CDD cd09917  F-box_SF  
Amino Acid Sequences MLPSIRIEKPAPKRQRTKKSKVAEDDPAFNSESSSSKGKAKATADQNRLITRRRGKGGKLRDLMNMPVDIFTEVCSYLDPYDLRRLALTSKRLWDILMTKDAKHIWKTALAAVPDLPECPKDINEPQYVCLLYSSECHTIVGPRHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.89
3 0.9
4 0.89
5 0.89
6 0.89
7 0.88
8 0.86
9 0.81
10 0.8
11 0.73
12 0.69
13 0.61
14 0.53
15 0.44
16 0.36
17 0.3
18 0.2
19 0.19
20 0.16
21 0.17
22 0.17
23 0.21
24 0.24
25 0.26
26 0.3
27 0.31
28 0.36
29 0.43
30 0.5
31 0.49
32 0.51
33 0.52
34 0.5
35 0.5
36 0.45
37 0.43
38 0.42
39 0.44
40 0.46
41 0.46
42 0.48
43 0.54
44 0.6
45 0.61
46 0.56
47 0.52
48 0.49
49 0.47
50 0.43
51 0.35
52 0.26
53 0.17
54 0.14
55 0.12
56 0.09
57 0.08
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.08
66 0.08
67 0.09
68 0.15
69 0.15
70 0.15
71 0.15
72 0.16
73 0.18
74 0.23
75 0.25
76 0.22
77 0.24
78 0.25
79 0.25
80 0.25
81 0.23
82 0.21
83 0.2
84 0.25
85 0.23
86 0.22
87 0.25
88 0.28
89 0.29
90 0.27
91 0.26
92 0.2
93 0.22
94 0.24
95 0.24
96 0.26
97 0.23
98 0.22
99 0.2
100 0.2
101 0.17
102 0.17
103 0.14
104 0.1
105 0.11
106 0.12
107 0.13
108 0.18
109 0.23
110 0.29
111 0.34
112 0.35
113 0.35
114 0.37
115 0.36
116 0.3
117 0.25
118 0.2
119 0.14
120 0.16
121 0.19
122 0.18
123 0.18
124 0.18
125 0.19
126 0.23