Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QV46

Protein Details
Accession A0A0C3QV46   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-32ILFTRRPKVYSKPVRRLQKRRELLFKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
Amino Acid Sequences MLKAIILFTRRPKVYSKPVRRLQKRRELLFKGFGYDLAVPRCSYIREALADVVLGCYVPLYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.63
4 0.64
5 0.72
6 0.81
7 0.87
8 0.89
9 0.88
10 0.87
11 0.85
12 0.8
13 0.8
14 0.75
15 0.68
16 0.65
17 0.55
18 0.46
19 0.38
20 0.32
21 0.25
22 0.21
23 0.2
24 0.14
25 0.15
26 0.13
27 0.14
28 0.15
29 0.14
30 0.14
31 0.14
32 0.15
33 0.16
34 0.17
35 0.17
36 0.16
37 0.15
38 0.14
39 0.12
40 0.09
41 0.07
42 0.05