Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3QJM2

Protein Details
Accession A0A0C3QJM2    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
115-137LDEYNEKKKNKVKPVAKVRLNVDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_nucl 13.5, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR018940  EF-1_beta_acid_region_euk  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR001859  T.cruzi_P2-like  
IPR001326  Transl_elong_EF1B_B/D_CS  
Gene Ontology GO:0005853  C:eukaryotic translation elongation factor 1 complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF10587  EF-1_beta_acid  
PROSITE View protein in PROSITE  
PS00824  EF1BD_1  
Amino Acid Sequences MSLDLKALNQHLSTRSYVEGYTPSQADVGVYTSVGSAPDAGQYPHAARWYKHIASYAQEHETLPGDKEASLKLFAAGASGAAAPAAAAEEEEDIDLFGSDDEEDPEAEAEKQRRLDEYNEKKKNKVKPVAKVRLNVDPDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.21
5 0.19
6 0.2
7 0.19
8 0.2
9 0.18
10 0.17
11 0.16
12 0.16
13 0.14
14 0.11
15 0.11
16 0.08
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.05
24 0.05
25 0.07
26 0.08
27 0.08
28 0.08
29 0.1
30 0.11
31 0.12
32 0.17
33 0.17
34 0.17
35 0.23
36 0.29
37 0.29
38 0.29
39 0.3
40 0.26
41 0.27
42 0.31
43 0.27
44 0.22
45 0.21
46 0.2
47 0.18
48 0.19
49 0.17
50 0.13
51 0.1
52 0.09
53 0.09
54 0.1
55 0.09
56 0.09
57 0.09
58 0.08
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.04
65 0.04
66 0.04
67 0.04
68 0.03
69 0.03
70 0.02
71 0.02
72 0.03
73 0.02
74 0.02
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.03
81 0.04
82 0.04
83 0.04
84 0.03
85 0.04
86 0.04
87 0.05
88 0.06
89 0.06
90 0.06
91 0.07
92 0.07
93 0.08
94 0.08
95 0.13
96 0.14
97 0.18
98 0.21
99 0.22
100 0.24
101 0.26
102 0.32
103 0.39
104 0.48
105 0.55
106 0.61
107 0.63
108 0.68
109 0.72
110 0.75
111 0.75
112 0.74
113 0.72
114 0.73
115 0.82
116 0.85
117 0.84
118 0.81
119 0.75
120 0.73