Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3Q8R5

Protein Details
Accession A0A0C3Q8R5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKSSKKPQGPKRRAVLDTBasic
NLS Segment(s)
PositionSequence
3-16KRKSSKKPQGPKRR
Subcellular Location(s) mito 20.5, mito_nucl 12.666, cyto_mito 12.333, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSKKPQGPKRRAVLDTTFTCLYCHHENAITCKLDKKESVGHLNCKICGQSFQCAIHHLSEPIDVYSEWIDAAEEAQATQGGSARRGAGALSDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.77
4 0.72
5 0.66
6 0.62
7 0.55
8 0.51
9 0.43
10 0.34
11 0.33
12 0.27
13 0.27
14 0.24
15 0.23
16 0.19
17 0.22
18 0.23
19 0.28
20 0.32
21 0.28
22 0.24
23 0.28
24 0.28
25 0.27
26 0.26
27 0.24
28 0.25
29 0.28
30 0.36
31 0.35
32 0.38
33 0.41
34 0.41
35 0.38
36 0.33
37 0.29
38 0.2
39 0.21
40 0.18
41 0.16
42 0.18
43 0.19
44 0.19
45 0.21
46 0.22
47 0.2
48 0.19
49 0.16
50 0.13
51 0.13
52 0.13
53 0.11
54 0.11
55 0.09
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.05
70 0.06
71 0.09
72 0.09
73 0.11
74 0.12
75 0.13
76 0.13
77 0.13
78 0.12
79 0.11