Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PM25

Protein Details
Accession A0A0C3PM25    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-92KGKNWRHAFKVRERVRRIRVNDBasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.333, mito_nucl 9.333, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013809  ENTH  
IPR008942  ENTH_VHS  
Gene Ontology GO:0051179  P:localization  
Pfam View protein in Pfam  
PF01417  ENTH  
PROSITE View protein in PROSITE  
PS50942  ENTH  
Amino Acid Sequences MSLQHFGKSALRVVKNYTKGYSDAQAKVRDATSNDPWGPSGTQMNELAELTYNQQDFVEIMEMLDKRLNDKGKNWRHAFKVRERVRRIRVND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.48
4 0.45
5 0.39
6 0.38
7 0.39
8 0.39
9 0.36
10 0.35
11 0.36
12 0.38
13 0.36
14 0.35
15 0.33
16 0.29
17 0.25
18 0.26
19 0.25
20 0.27
21 0.26
22 0.25
23 0.24
24 0.23
25 0.21
26 0.17
27 0.16
28 0.11
29 0.13
30 0.13
31 0.13
32 0.12
33 0.12
34 0.11
35 0.08
36 0.08
37 0.07
38 0.09
39 0.09
40 0.09
41 0.08
42 0.09
43 0.08
44 0.09
45 0.09
46 0.06
47 0.06
48 0.09
49 0.09
50 0.1
51 0.12
52 0.11
53 0.12
54 0.18
55 0.23
56 0.22
57 0.29
58 0.39
59 0.47
60 0.57
61 0.61
62 0.62
63 0.65
64 0.71
65 0.71
66 0.71
67 0.72
68 0.71
69 0.76
70 0.78
71 0.8
72 0.81