Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3LG68

Protein Details
Accession A0A0C3LG68    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-112IDDTALKRRAKRRQWAGKYDERLPHydrophilic
NLS Segment(s)
PositionSequence
96-101RRAKRR
Subcellular Location(s) extr 16, golg 5, mito 2, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences MDRPQTFTSLDLKPKRWHGYAVVLFILGTLFPPLAVAARFGFGKDFFLNLILTLCGYFPGHGHNFYIQNIRNNKNARRTPKWAVRYGLIDDTALKRRAKRRQWAGKYDERLPQSTLEGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.56
4 0.53
5 0.47
6 0.51
7 0.49
8 0.45
9 0.37
10 0.3
11 0.28
12 0.24
13 0.2
14 0.1
15 0.06
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.05
23 0.07
24 0.06
25 0.08
26 0.08
27 0.08
28 0.09
29 0.08
30 0.11
31 0.1
32 0.1
33 0.09
34 0.1
35 0.1
36 0.09
37 0.09
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.08
47 0.1
48 0.1
49 0.11
50 0.13
51 0.14
52 0.15
53 0.2
54 0.18
55 0.24
56 0.3
57 0.32
58 0.36
59 0.4
60 0.44
61 0.49
62 0.54
63 0.56
64 0.57
65 0.62
66 0.64
67 0.68
68 0.69
69 0.65
70 0.6
71 0.55
72 0.51
73 0.47
74 0.4
75 0.31
76 0.25
77 0.21
78 0.23
79 0.26
80 0.27
81 0.26
82 0.31
83 0.39
84 0.5
85 0.57
86 0.64
87 0.69
88 0.76
89 0.83
90 0.86
91 0.85
92 0.84
93 0.81
94 0.76
95 0.72
96 0.64
97 0.57
98 0.5
99 0.43