Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3Q7V1

Protein Details
Accession A0A0C3Q7V1    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
101-127QKEQSAKTLRRHKKDIHFPRHRNFVLKBasic
NLS Segment(s)
PositionSequence
87-120LRPKQTRAIRRRLSQKEQSAKTLRRHKKDIHFPR
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAGGPPKHRSNELRSKNKADLLKSLEELKRELVDLRVHKVTNASAGKLSRISVVRKNIARILTIMNQKTRQAIREHYKGQKYRPLDLRPKQTRAIRRRLSQKEQSAKTLRRHKKDIHFPRHRNFVLKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.71
4 0.71
5 0.67
6 0.58
7 0.55
8 0.5
9 0.47
10 0.42
11 0.44
12 0.39
13 0.36
14 0.34
15 0.29
16 0.24
17 0.21
18 0.21
19 0.17
20 0.22
21 0.23
22 0.26
23 0.28
24 0.27
25 0.26
26 0.27
27 0.24
28 0.25
29 0.24
30 0.2
31 0.19
32 0.2
33 0.21
34 0.2
35 0.2
36 0.15
37 0.17
38 0.19
39 0.22
40 0.27
41 0.31
42 0.32
43 0.34
44 0.33
45 0.31
46 0.28
47 0.24
48 0.22
49 0.21
50 0.25
51 0.25
52 0.24
53 0.24
54 0.24
55 0.27
56 0.25
57 0.23
58 0.21
59 0.27
60 0.32
61 0.37
62 0.42
63 0.46
64 0.52
65 0.53
66 0.54
67 0.54
68 0.5
69 0.51
70 0.53
71 0.54
72 0.57
73 0.6
74 0.67
75 0.67
76 0.68
77 0.68
78 0.67
79 0.69
80 0.67
81 0.71
82 0.67
83 0.68
84 0.75
85 0.77
86 0.79
87 0.78
88 0.79
89 0.78
90 0.74
91 0.75
92 0.73
93 0.71
94 0.72
95 0.73
96 0.73
97 0.71
98 0.76
99 0.76
100 0.78
101 0.82
102 0.84
103 0.84
104 0.86
105 0.86
106 0.87
107 0.88
108 0.81
109 0.75