Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3QC81

Protein Details
Accession A0A0C3QC81    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-59SSNAGPPTKVRKPRKRWTMEEHydrophilic
NLS Segment(s)
PositionSequence
49-53RKPRK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
CDD cd11660  SANT_TRF  
Amino Acid Sequences MPSASSSTTNGNSHSTSSASSSLSPPPPELSAAQGEPSSSNAGPPTKVRKPRKRWTMEETQALVDGCNKWGVGNWKAILNDTQFQFQGRSPVDLKDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.17
4 0.19
5 0.18
6 0.16
7 0.17
8 0.17
9 0.21
10 0.23
11 0.23
12 0.22
13 0.22
14 0.22
15 0.22
16 0.21
17 0.18
18 0.17
19 0.16
20 0.16
21 0.14
22 0.13
23 0.12
24 0.13
25 0.12
26 0.1
27 0.1
28 0.11
29 0.12
30 0.13
31 0.15
32 0.22
33 0.26
34 0.36
35 0.46
36 0.55
37 0.64
38 0.73
39 0.8
40 0.8
41 0.79
42 0.77
43 0.77
44 0.72
45 0.67
46 0.59
47 0.48
48 0.42
49 0.35
50 0.28
51 0.2
52 0.15
53 0.11
54 0.1
55 0.09
56 0.08
57 0.11
58 0.17
59 0.17
60 0.22
61 0.22
62 0.24
63 0.25
64 0.26
65 0.26
66 0.24
67 0.26
68 0.23
69 0.25
70 0.22
71 0.23
72 0.24
73 0.22
74 0.27
75 0.24
76 0.27
77 0.26