Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q2P2

Protein Details
Accession A0A0C3Q2P2   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-109TPMFTRRRSESRRVRRERGKSDRYPIGBasic
NLS Segment(s)
PositionSequence
88-102RRRSESRRVRRERGK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001580  Calret/calnex  
IPR009033  Calreticulin/calnexin_P_dom_sf  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005509  F:calcium ion binding  
GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
Pfam View protein in Pfam  
PF00262  Calreticulin  
Amino Acid Sequences MSPAVDGGSGDDVGDPLVKDRKPEDWADEAQIRDPDAVKPDDQDEDVPFQILDEDVSLSSPLVTRHGPDGEGWPLASPRRSSTPMFTRRRSESRRVRRERGKSDRYPIGYGVSDIRSPSSARPFRHLSTSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.16
5 0.16
6 0.19
7 0.21
8 0.25
9 0.28
10 0.31
11 0.33
12 0.32
13 0.33
14 0.36
15 0.37
16 0.33
17 0.32
18 0.3
19 0.25
20 0.21
21 0.2
22 0.16
23 0.17
24 0.18
25 0.15
26 0.16
27 0.17
28 0.17
29 0.17
30 0.17
31 0.15
32 0.16
33 0.15
34 0.14
35 0.12
36 0.1
37 0.1
38 0.08
39 0.07
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.04
46 0.04
47 0.05
48 0.05
49 0.07
50 0.07
51 0.08
52 0.1
53 0.1
54 0.1
55 0.1
56 0.12
57 0.12
58 0.12
59 0.11
60 0.09
61 0.1
62 0.11
63 0.13
64 0.11
65 0.12
66 0.17
67 0.2
68 0.21
69 0.27
70 0.36
71 0.44
72 0.5
73 0.52
74 0.53
75 0.57
76 0.65
77 0.65
78 0.65
79 0.66
80 0.71
81 0.77
82 0.8
83 0.83
84 0.83
85 0.87
86 0.87
87 0.87
88 0.85
89 0.81
90 0.8
91 0.78
92 0.72
93 0.64
94 0.55
95 0.48
96 0.39
97 0.33
98 0.29
99 0.23
100 0.2
101 0.18
102 0.19
103 0.17
104 0.18
105 0.22
106 0.29
107 0.34
108 0.36
109 0.42
110 0.47
111 0.48