Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3LKJ3

Protein Details
Accession A0A0C3LKJ3    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
123-142PYQGARKKVKYPRSERHDNMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011146  HIT-like  
IPR036265  HIT-like_sf  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF11969  DcpS_C  
PROSITE View protein in PROSITE  
PS51084  HIT_2  
Amino Acid Sequences MIWKLLTHPFRPLDPNAHDRSVRPKCVFCHIEKEKILAESDEFLVFRDRNPAAKEHLLVTSRQHIESVRTLTMDDIPLLKTMEEAGKLALLNLGHPEDTHVLGYHIPPFNSINHLHLHAQALPYQGARKKVKYPRSERHDNMKGWTWFIESSQVQRTLEAHRNVTIKPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.48
4 0.5
5 0.48
6 0.45
7 0.51
8 0.52
9 0.54
10 0.5
11 0.49
12 0.47
13 0.56
14 0.58
15 0.51
16 0.53
17 0.5
18 0.54
19 0.51
20 0.5
21 0.43
22 0.39
23 0.37
24 0.27
25 0.23
26 0.16
27 0.17
28 0.15
29 0.12
30 0.12
31 0.15
32 0.14
33 0.13
34 0.18
35 0.17
36 0.21
37 0.23
38 0.24
39 0.25
40 0.28
41 0.28
42 0.23
43 0.26
44 0.23
45 0.22
46 0.22
47 0.25
48 0.24
49 0.23
50 0.22
51 0.19
52 0.21
53 0.24
54 0.24
55 0.17
56 0.16
57 0.16
58 0.16
59 0.16
60 0.13
61 0.1
62 0.08
63 0.08
64 0.08
65 0.08
66 0.07
67 0.06
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.06
78 0.05
79 0.06
80 0.07
81 0.06
82 0.06
83 0.08
84 0.08
85 0.08
86 0.09
87 0.08
88 0.08
89 0.09
90 0.09
91 0.13
92 0.13
93 0.13
94 0.14
95 0.15
96 0.15
97 0.19
98 0.19
99 0.16
100 0.16
101 0.18
102 0.18
103 0.18
104 0.19
105 0.17
106 0.16
107 0.16
108 0.16
109 0.15
110 0.15
111 0.18
112 0.2
113 0.27
114 0.3
115 0.33
116 0.41
117 0.49
118 0.58
119 0.63
120 0.7
121 0.72
122 0.76
123 0.83
124 0.78
125 0.8
126 0.79
127 0.71
128 0.66
129 0.64
130 0.56
131 0.48
132 0.44
133 0.35
134 0.28
135 0.26
136 0.29
137 0.21
138 0.24
139 0.29
140 0.32
141 0.29
142 0.3
143 0.32
144 0.32
145 0.4
146 0.4
147 0.36
148 0.38
149 0.4