Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3L6K2

Protein Details
Accession A0A0C3L6K2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-99RTSFRRPDPQAVKTKNKKIRHydrophilic
NLS Segment(s)
PositionSequence
94-99KNKKIR
Subcellular Location(s) mito 19.5, cyto_mito 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MYLGLVQLTGGHMPRARANRHQIRLNNPALNGVVPPKNLRPMGTVRTDTHATVSLYEFSFFSFFSISHLNGHGSVRRYSRTSFRRPDPQAVKTKNKKIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.32
4 0.38
5 0.48
6 0.55
7 0.6
8 0.66
9 0.65
10 0.65
11 0.69
12 0.67
13 0.59
14 0.49
15 0.44
16 0.36
17 0.31
18 0.24
19 0.2
20 0.16
21 0.14
22 0.16
23 0.17
24 0.21
25 0.22
26 0.22
27 0.21
28 0.23
29 0.26
30 0.28
31 0.3
32 0.25
33 0.28
34 0.29
35 0.25
36 0.22
37 0.21
38 0.16
39 0.14
40 0.14
41 0.12
42 0.11
43 0.12
44 0.1
45 0.08
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.08
52 0.1
53 0.11
54 0.11
55 0.13
56 0.13
57 0.14
58 0.16
59 0.17
60 0.18
61 0.21
62 0.23
63 0.25
64 0.27
65 0.29
66 0.38
67 0.42
68 0.5
69 0.54
70 0.59
71 0.67
72 0.7
73 0.77
74 0.75
75 0.75
76 0.75
77 0.75
78 0.78
79 0.78