Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PYN9

Protein Details
Accession A0A0C3PYN9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-52SVVSEKKRRAMRTRMRTRKTRKTRKTTRSLAATHydrophilic
NLS Segment(s)
PositionSequence
25-45KKRRAMRTRMRTRKTRKTRKT
Subcellular Location(s) mito 15.5, cyto_mito 12.333, cyto 8, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MMTMKVASRMLNWAGLAMKSVVSEKKRRAMRTRMRTRKTRKTRKTTRSLAATWRDLLMMKLKKAMVMVMAVKTLARKKNELFIYLLKIVIFPWCNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.12
5 0.11
6 0.09
7 0.12
8 0.16
9 0.2
10 0.27
11 0.31
12 0.38
13 0.45
14 0.51
15 0.57
16 0.62
17 0.68
18 0.72
19 0.79
20 0.81
21 0.82
22 0.85
23 0.86
24 0.86
25 0.87
26 0.87
27 0.86
28 0.86
29 0.9
30 0.9
31 0.9
32 0.86
33 0.8
34 0.74
35 0.66
36 0.61
37 0.55
38 0.47
39 0.38
40 0.31
41 0.25
42 0.2
43 0.19
44 0.2
45 0.19
46 0.17
47 0.2
48 0.2
49 0.2
50 0.2
51 0.2
52 0.13
53 0.12
54 0.13
55 0.11
56 0.11
57 0.1
58 0.1
59 0.13
60 0.19
61 0.23
62 0.24
63 0.28
64 0.3
65 0.39
66 0.42
67 0.41
68 0.38
69 0.36
70 0.39
71 0.35
72 0.34
73 0.25
74 0.22
75 0.2
76 0.23