Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3L1V6

Protein Details
Accession A0A0C3L1V6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-48DSGWKHQNKKRPKIKKIFAVCLHydrophilic
NLS Segment(s)
PositionSequence
35-42KKRPKIKK
Subcellular Location(s) cyto_nucl 11.833, nucl 11, cyto 10.5, cyto_mito 7.666, mito 3.5
Family & Domain DBs
Amino Acid Sequences MKTTLRVLDEFHWNDSYEYQKVVGLFDSGWKHQNKKRPKIKKIFAVCLPDHLNESYEAYKKHLEAHLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.29
4 0.2
5 0.19
6 0.16
7 0.16
8 0.15
9 0.15
10 0.13
11 0.09
12 0.08
13 0.12
14 0.14
15 0.14
16 0.19
17 0.2
18 0.26
19 0.28
20 0.37
21 0.43
22 0.51
23 0.61
24 0.66
25 0.74
26 0.79
27 0.83
28 0.84
29 0.82
30 0.78
31 0.73
32 0.69
33 0.59
34 0.54
35 0.49
36 0.4
37 0.35
38 0.29
39 0.24
40 0.18
41 0.22
42 0.2
43 0.21
44 0.21
45 0.23
46 0.25
47 0.25
48 0.3