Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3Q9J4

Protein Details
Accession A0A0C3Q9J4   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-30SNVVQRLQGRPPRHRQRILAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 9, cyto 4, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029020  Ammonium/urea_transptr  
IPR001905  Ammonium_transpt  
IPR024041  NH4_transpt_AmtB-like_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0008519  F:ammonium transmembrane transporter activity  
Pfam View protein in Pfam  
PF00909  Ammonium_transp  
Amino Acid Sequences MALAKCSKPWSNVVQRLQGRPPRHRQRILASIQSTIVQRSTEQRNASGGSTQLPSSSPSLYLVVRRSAYPSNRIHSKPAIYSMDLEPAHTGNRRERLCLGYCLGRTRRVTAGCSDPKAIVDITRPNEYRAGFIYVNGPPISSFRDDLKLGVKYVATWNRGGLMNEFITVTNLAASVGGLTWMLWDWRVEGWLDRNWVQLGYQLADTTAGISYSLVMTTIILWIMHFIPGCRLRTDEESEIIRIDDAEMGEFAYDYVAVDTELDPKAELADAPDHGRGGAGNIEESHSHPHSIEHEKVGPPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.69
4 0.72
5 0.7
6 0.68
7 0.68
8 0.73
9 0.75
10 0.79
11 0.81
12 0.78
13 0.78
14 0.8
15 0.76
16 0.74
17 0.64
18 0.55
19 0.49
20 0.45
21 0.38
22 0.29
23 0.24
24 0.16
25 0.16
26 0.22
27 0.28
28 0.32
29 0.33
30 0.33
31 0.34
32 0.36
33 0.35
34 0.3
35 0.23
36 0.2
37 0.19
38 0.18
39 0.15
40 0.14
41 0.15
42 0.15
43 0.15
44 0.13
45 0.13
46 0.15
47 0.16
48 0.19
49 0.2
50 0.22
51 0.22
52 0.22
53 0.25
54 0.3
55 0.33
56 0.37
57 0.39
58 0.41
59 0.47
60 0.49
61 0.49
62 0.47
63 0.47
64 0.4
65 0.42
66 0.38
67 0.32
68 0.33
69 0.29
70 0.31
71 0.27
72 0.26
73 0.2
74 0.18
75 0.2
76 0.2
77 0.22
78 0.21
79 0.29
80 0.29
81 0.31
82 0.33
83 0.35
84 0.35
85 0.35
86 0.31
87 0.28
88 0.29
89 0.33
90 0.33
91 0.34
92 0.32
93 0.33
94 0.35
95 0.32
96 0.33
97 0.29
98 0.36
99 0.34
100 0.35
101 0.32
102 0.28
103 0.26
104 0.25
105 0.22
106 0.14
107 0.13
108 0.17
109 0.18
110 0.24
111 0.24
112 0.24
113 0.27
114 0.26
115 0.24
116 0.2
117 0.22
118 0.17
119 0.17
120 0.19
121 0.16
122 0.18
123 0.17
124 0.15
125 0.1
126 0.11
127 0.13
128 0.11
129 0.12
130 0.11
131 0.14
132 0.14
133 0.15
134 0.18
135 0.16
136 0.15
137 0.15
138 0.13
139 0.11
140 0.17
141 0.2
142 0.18
143 0.18
144 0.17
145 0.19
146 0.2
147 0.2
148 0.15
149 0.13
150 0.11
151 0.11
152 0.12
153 0.09
154 0.09
155 0.09
156 0.08
157 0.05
158 0.05
159 0.04
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.04
171 0.04
172 0.05
173 0.05
174 0.06
175 0.06
176 0.08
177 0.11
178 0.13
179 0.16
180 0.16
181 0.17
182 0.17
183 0.17
184 0.15
185 0.15
186 0.14
187 0.12
188 0.12
189 0.1
190 0.1
191 0.1
192 0.1
193 0.08
194 0.06
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.05
207 0.04
208 0.04
209 0.06
210 0.06
211 0.08
212 0.08
213 0.08
214 0.14
215 0.2
216 0.22
217 0.21
218 0.22
219 0.24
220 0.29
221 0.35
222 0.3
223 0.29
224 0.29
225 0.29
226 0.28
227 0.24
228 0.2
229 0.14
230 0.12
231 0.1
232 0.08
233 0.08
234 0.08
235 0.07
236 0.07
237 0.07
238 0.06
239 0.05
240 0.05
241 0.04
242 0.04
243 0.05
244 0.05
245 0.06
246 0.06
247 0.1
248 0.11
249 0.11
250 0.11
251 0.11
252 0.11
253 0.11
254 0.1
255 0.09
256 0.12
257 0.14
258 0.16
259 0.17
260 0.17
261 0.16
262 0.16
263 0.13
264 0.12
265 0.13
266 0.11
267 0.12
268 0.12
269 0.14
270 0.15
271 0.17
272 0.22
273 0.2
274 0.21
275 0.2
276 0.22
277 0.27
278 0.33
279 0.35
280 0.34
281 0.38