Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3L2K8

Protein Details
Accession A0A0C3L2K8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
345-365QDGETKKRRSSAKRAVRHKIYBasic
NLS Segment(s)
PositionSequence
350-363KKRRSSAKRAVRHK
Subcellular Location(s) extr 21, mito 2, cyto 1, pero 1, golg 1, vacu 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009030  Growth_fac_rcpt_cys_sf  
Amino Acid Sequences MLFRAPVIILAALLAKSALATCPAGSYYRRISSNKYACTVCPSGQYTTSPNLSDSCNQCSAGQGHNSDHTGCVPCVDGTYSSRGTGCQNCAAGKTSTKDHKHCTNCSGETYSRGGTSCMTCPAGKQRNDDRTDCDECSPGSYNSTPGGTCKKCPAGQFNNVSGAESCCDCCAGYYSTNSRTSCSKCEDYNQYAPRKKYSAVGSNSSGDCKLVQGTLPTPPATCTQPANNACPTTTPGGPQGSPTSRKRRDDQCGNGLISCPIHEGRGPSKCVNPQTDDHFCGGCVGDIGIGSGEDCSLSGEHCVNGHCVSHPVSRREGVKSPDGSSCVLAPCASGSPVSDGLHAQDGETKKRRSSAKRAVRHKIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.07
6 0.07
7 0.08
8 0.09
9 0.1
10 0.12
11 0.15
12 0.16
13 0.21
14 0.25
15 0.31
16 0.36
17 0.37
18 0.43
19 0.52
20 0.59
21 0.58
22 0.56
23 0.51
24 0.47
25 0.52
26 0.48
27 0.39
28 0.37
29 0.35
30 0.34
31 0.34
32 0.36
33 0.32
34 0.33
35 0.35
36 0.29
37 0.27
38 0.25
39 0.26
40 0.31
41 0.3
42 0.31
43 0.3
44 0.3
45 0.29
46 0.32
47 0.31
48 0.3
49 0.31
50 0.28
51 0.27
52 0.3
53 0.31
54 0.27
55 0.25
56 0.23
57 0.22
58 0.19
59 0.18
60 0.16
61 0.14
62 0.15
63 0.15
64 0.14
65 0.13
66 0.18
67 0.18
68 0.18
69 0.18
70 0.18
71 0.21
72 0.24
73 0.26
74 0.24
75 0.26
76 0.25
77 0.27
78 0.29
79 0.26
80 0.24
81 0.24
82 0.27
83 0.34
84 0.4
85 0.44
86 0.47
87 0.54
88 0.58
89 0.59
90 0.58
91 0.56
92 0.5
93 0.49
94 0.47
95 0.39
96 0.35
97 0.34
98 0.29
99 0.23
100 0.22
101 0.19
102 0.16
103 0.17
104 0.15
105 0.15
106 0.17
107 0.15
108 0.17
109 0.27
110 0.33
111 0.34
112 0.4
113 0.46
114 0.53
115 0.57
116 0.57
117 0.53
118 0.52
119 0.53
120 0.47
121 0.4
122 0.32
123 0.27
124 0.29
125 0.25
126 0.19
127 0.17
128 0.16
129 0.16
130 0.16
131 0.17
132 0.14
133 0.13
134 0.21
135 0.2
136 0.21
137 0.24
138 0.28
139 0.3
140 0.33
141 0.4
142 0.38
143 0.44
144 0.47
145 0.44
146 0.45
147 0.42
148 0.39
149 0.31
150 0.25
151 0.18
152 0.14
153 0.12
154 0.07
155 0.07
156 0.06
157 0.06
158 0.08
159 0.09
160 0.1
161 0.13
162 0.16
163 0.2
164 0.25
165 0.25
166 0.24
167 0.26
168 0.28
169 0.29
170 0.31
171 0.29
172 0.25
173 0.3
174 0.35
175 0.37
176 0.42
177 0.45
178 0.47
179 0.5
180 0.51
181 0.49
182 0.44
183 0.39
184 0.37
185 0.36
186 0.36
187 0.34
188 0.37
189 0.36
190 0.36
191 0.36
192 0.31
193 0.26
194 0.18
195 0.14
196 0.11
197 0.09
198 0.07
199 0.07
200 0.07
201 0.09
202 0.11
203 0.13
204 0.13
205 0.13
206 0.14
207 0.16
208 0.16
209 0.17
210 0.16
211 0.17
212 0.25
213 0.27
214 0.29
215 0.3
216 0.28
217 0.27
218 0.26
219 0.26
220 0.2
221 0.18
222 0.16
223 0.17
224 0.19
225 0.19
226 0.19
227 0.22
228 0.24
229 0.3
230 0.36
231 0.43
232 0.49
233 0.54
234 0.59
235 0.63
236 0.68
237 0.71
238 0.72
239 0.69
240 0.66
241 0.62
242 0.55
243 0.47
244 0.38
245 0.28
246 0.21
247 0.16
248 0.11
249 0.11
250 0.12
251 0.15
252 0.2
253 0.26
254 0.3
255 0.29
256 0.34
257 0.39
258 0.44
259 0.45
260 0.42
261 0.4
262 0.43
263 0.47
264 0.44
265 0.4
266 0.35
267 0.3
268 0.27
269 0.24
270 0.16
271 0.11
272 0.08
273 0.06
274 0.06
275 0.06
276 0.05
277 0.05
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.05
284 0.05
285 0.06
286 0.08
287 0.09
288 0.09
289 0.11
290 0.12
291 0.13
292 0.14
293 0.15
294 0.14
295 0.16
296 0.19
297 0.25
298 0.31
299 0.32
300 0.36
301 0.39
302 0.42
303 0.45
304 0.48
305 0.45
306 0.46
307 0.46
308 0.45
309 0.44
310 0.43
311 0.38
312 0.33
313 0.3
314 0.24
315 0.21
316 0.18
317 0.15
318 0.14
319 0.14
320 0.13
321 0.11
322 0.11
323 0.14
324 0.17
325 0.18
326 0.17
327 0.16
328 0.18
329 0.23
330 0.21
331 0.18
332 0.21
333 0.24
334 0.32
335 0.4
336 0.42
337 0.4
338 0.48
339 0.57
340 0.6
341 0.68
342 0.69
343 0.72
344 0.78
345 0.85