Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3I6V1

Protein Details
Accession A0A0C3I6V1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-101RYCSKDCQVKHWKIHKRRCTSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR024119  TF_DEAF-1  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS01360  ZF_MYND_1  
PS50865  ZF_MYND_2  
Amino Acid Sequences PWCSCGMGVGAEVLRGRYGSVAAKYATRAAISPLFAVSYLEGIGMKPTDVPPVEPALARCAACGKGGVPLSRCGRCKAIRYCSKDCQVKHWKIHKRRCTST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.09
6 0.11
7 0.13
8 0.14
9 0.15
10 0.16
11 0.17
12 0.18
13 0.17
14 0.14
15 0.12
16 0.13
17 0.15
18 0.14
19 0.14
20 0.12
21 0.11
22 0.11
23 0.11
24 0.08
25 0.06
26 0.05
27 0.05
28 0.05
29 0.04
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.08
36 0.08
37 0.09
38 0.09
39 0.11
40 0.12
41 0.12
42 0.12
43 0.12
44 0.14
45 0.13
46 0.12
47 0.12
48 0.12
49 0.12
50 0.12
51 0.09
52 0.12
53 0.15
54 0.17
55 0.16
56 0.22
57 0.27
58 0.32
59 0.34
60 0.32
61 0.37
62 0.39
63 0.47
64 0.49
65 0.55
66 0.58
67 0.65
68 0.69
69 0.7
70 0.75
71 0.74
72 0.66
73 0.66
74 0.68
75 0.69
76 0.71
77 0.73
78 0.75
79 0.79
80 0.88
81 0.88