Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NUR0

Protein Details
Accession A0A0C3NUR0    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-56AGNRNRSCDHCRRRHIKCITDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
Amino Acid Sequences MAPSSKESLPKHPHLLVPACYACHKKKKSCVVTANAGNRNRSCDHCRRRHIKCITDEAEAGVCNGMKRRHADDGVDEVRKKQSLGRSGDVVRIQDAEKGTQKGRVKVEDRRDVLEVADASGDKSTRLETTLQELTQVITRNMTVISEERRERAECDRKTSETMNMMLKVMYKIMDASPLPSGSKDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.48
4 0.46
5 0.41
6 0.36
7 0.37
8 0.41
9 0.42
10 0.47
11 0.52
12 0.54
13 0.62
14 0.71
15 0.76
16 0.79
17 0.79
18 0.75
19 0.76
20 0.75
21 0.74
22 0.7
23 0.65
24 0.6
25 0.52
26 0.51
27 0.45
28 0.43
29 0.43
30 0.46
31 0.54
32 0.59
33 0.68
34 0.72
35 0.76
36 0.81
37 0.81
38 0.78
39 0.73
40 0.72
41 0.65
42 0.58
43 0.51
44 0.42
45 0.34
46 0.26
47 0.21
48 0.12
49 0.09
50 0.07
51 0.11
52 0.12
53 0.14
54 0.18
55 0.21
56 0.26
57 0.26
58 0.27
59 0.25
60 0.31
61 0.32
62 0.32
63 0.28
64 0.24
65 0.25
66 0.24
67 0.22
68 0.18
69 0.2
70 0.25
71 0.3
72 0.3
73 0.31
74 0.32
75 0.35
76 0.33
77 0.27
78 0.2
79 0.16
80 0.15
81 0.14
82 0.13
83 0.12
84 0.14
85 0.16
86 0.16
87 0.21
88 0.24
89 0.27
90 0.29
91 0.33
92 0.34
93 0.4
94 0.48
95 0.5
96 0.49
97 0.46
98 0.44
99 0.38
100 0.34
101 0.29
102 0.21
103 0.12
104 0.11
105 0.09
106 0.08
107 0.08
108 0.08
109 0.06
110 0.06
111 0.07
112 0.07
113 0.09
114 0.1
115 0.1
116 0.16
117 0.19
118 0.18
119 0.18
120 0.17
121 0.17
122 0.18
123 0.19
124 0.14
125 0.12
126 0.12
127 0.12
128 0.12
129 0.11
130 0.1
131 0.11
132 0.16
133 0.21
134 0.22
135 0.23
136 0.27
137 0.28
138 0.29
139 0.36
140 0.42
141 0.39
142 0.46
143 0.5
144 0.5
145 0.53
146 0.52
147 0.47
148 0.41
149 0.41
150 0.38
151 0.33
152 0.31
153 0.27
154 0.26
155 0.22
156 0.19
157 0.16
158 0.11
159 0.12
160 0.12
161 0.17
162 0.15
163 0.17
164 0.19
165 0.2
166 0.21