Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NKI6

Protein Details
Accession A0A0C3NKI6    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-38LSGSRKSRRNRVCSWKSRAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 10.666, nucl 6.5, cyto_nucl 5.166, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRLSPVHGWPLDHGYSLMLSGSRKSRRNRVCSWKSRAGMVVPGRPLACSHDMIDMFNGTQGVSKPHVPRIWVGDASPHAPRPHSLRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.12
5 0.08
6 0.08
7 0.11
8 0.18
9 0.25
10 0.31
11 0.37
12 0.47
13 0.55
14 0.62
15 0.68
16 0.72
17 0.75
18 0.77
19 0.8
20 0.78
21 0.7
22 0.63
23 0.56
24 0.45
25 0.41
26 0.35
27 0.3
28 0.22
29 0.22
30 0.2
31 0.19
32 0.18
33 0.16
34 0.15
35 0.13
36 0.13
37 0.16
38 0.16
39 0.16
40 0.16
41 0.13
42 0.11
43 0.1
44 0.09
45 0.06
46 0.07
47 0.07
48 0.1
49 0.12
50 0.17
51 0.19
52 0.26
53 0.28
54 0.28
55 0.3
56 0.33
57 0.36
58 0.32
59 0.29
60 0.28
61 0.29
62 0.3
63 0.31
64 0.29
65 0.26
66 0.27
67 0.3