Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3IKG3

Protein Details
Accession A0A0C3IKG3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-123ADLLRSKNARRLRKKTPQTGWKGRVPYHydrophilic
NLS Segment(s)
PositionSequence
105-111ARRLRKK
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MYELQQWANFWPRPYLTPIQTWSTGTDPSIQLESRPGIKVNAKVFFFCTIKVERIIRKDMLANERIMMQLYWPNDQTPRRASSQAVGRVTMASLEAADLLRSKNARRLRKKTPQTGWKGRVPYSCSCPNVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.35
4 0.38
5 0.4
6 0.4
7 0.39
8 0.38
9 0.34
10 0.29
11 0.26
12 0.22
13 0.22
14 0.18
15 0.18
16 0.2
17 0.17
18 0.15
19 0.17
20 0.18
21 0.17
22 0.18
23 0.17
24 0.18
25 0.22
26 0.27
27 0.29
28 0.32
29 0.3
30 0.29
31 0.3
32 0.31
33 0.28
34 0.22
35 0.21
36 0.18
37 0.19
38 0.22
39 0.24
40 0.23
41 0.27
42 0.3
43 0.27
44 0.26
45 0.27
46 0.28
47 0.29
48 0.27
49 0.23
50 0.19
51 0.19
52 0.18
53 0.15
54 0.11
55 0.07
56 0.08
57 0.09
58 0.11
59 0.11
60 0.12
61 0.16
62 0.17
63 0.2
64 0.22
65 0.24
66 0.25
67 0.26
68 0.26
69 0.27
70 0.33
71 0.36
72 0.33
73 0.3
74 0.28
75 0.26
76 0.25
77 0.2
78 0.13
79 0.06
80 0.05
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.09
88 0.11
89 0.13
90 0.21
91 0.3
92 0.4
93 0.5
94 0.57
95 0.65
96 0.74
97 0.83
98 0.86
99 0.87
100 0.87
101 0.87
102 0.89
103 0.85
104 0.81
105 0.76
106 0.71
107 0.68
108 0.62
109 0.58
110 0.55
111 0.57