Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NKJ9

Protein Details
Accession A0A0C3NKJ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-66KGGPKTPKSCKEKWKRLQSTYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 6.5, cyto_mito 5.5, cyto 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences SWSDKDTFALLDFIDSHKATAGDSLNFKAPFWNACAASPMLANPEKGGPKTPKSCKEKWKRLQSTYMVIDHLSCSSGFVYSLKSGADIGVANENSWDGYVKVHKDAAPYKNKGWLFYDRMSALIPSKCKGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.15
5 0.15
6 0.13
7 0.17
8 0.17
9 0.16
10 0.18
11 0.2
12 0.24
13 0.24
14 0.24
15 0.22
16 0.21
17 0.19
18 0.2
19 0.23
20 0.18
21 0.19
22 0.21
23 0.19
24 0.18
25 0.17
26 0.14
27 0.14
28 0.14
29 0.14
30 0.12
31 0.15
32 0.17
33 0.17
34 0.23
35 0.23
36 0.28
37 0.37
38 0.44
39 0.5
40 0.55
41 0.61
42 0.66
43 0.73
44 0.77
45 0.78
46 0.82
47 0.8
48 0.76
49 0.76
50 0.69
51 0.63
52 0.55
53 0.46
54 0.35
55 0.27
56 0.24
57 0.17
58 0.14
59 0.09
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.08
67 0.07
68 0.08
69 0.07
70 0.07
71 0.07
72 0.07
73 0.08
74 0.06
75 0.06
76 0.11
77 0.11
78 0.1
79 0.1
80 0.1
81 0.09
82 0.1
83 0.09
84 0.05
85 0.08
86 0.12
87 0.14
88 0.16
89 0.19
90 0.2
91 0.25
92 0.32
93 0.38
94 0.43
95 0.46
96 0.45
97 0.51
98 0.51
99 0.48
100 0.45
101 0.44
102 0.41
103 0.39
104 0.43
105 0.35
106 0.35
107 0.33
108 0.31
109 0.28
110 0.27
111 0.27
112 0.23