Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PAA9

Protein Details
Accession A0A0C3PAA9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-65ENLPNKGKVKGRRKNRRRKQHLPKLASNFIHydrophilic
NLS Segment(s)
PositionSequence
41-56KGKVKGRRKNRRRKQH
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTSAAKAYIALGLTGHGYGSPAAYVRQRNQTESVLENLPNKGKVKGRRKNRRRKQHLPKLASNFISEVKQGFSAETVQTFATGIHVRTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.05
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.08
10 0.12
11 0.17
12 0.2
13 0.3
14 0.31
15 0.34
16 0.37
17 0.37
18 0.35
19 0.32
20 0.31
21 0.23
22 0.23
23 0.21
24 0.2
25 0.19
26 0.19
27 0.19
28 0.19
29 0.23
30 0.31
31 0.41
32 0.47
33 0.57
34 0.66
35 0.75
36 0.83
37 0.88
38 0.9
39 0.89
40 0.92
41 0.93
42 0.93
43 0.92
44 0.88
45 0.86
46 0.82
47 0.77
48 0.67
49 0.57
50 0.47
51 0.38
52 0.32
53 0.24
54 0.18
55 0.14
56 0.14
57 0.13
58 0.12
59 0.11
60 0.13
61 0.13
62 0.13
63 0.13
64 0.11
65 0.11
66 0.11
67 0.1
68 0.12
69 0.14