Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NY71

Protein Details
Accession A0A0C3NY71    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-60STDDWMKRRRLRKMKRTKRKMEQEMNKEGQBasic
NLS Segment(s)
PositionSequence
37-50KRRRLRKMKRTKRK
Subcellular Location(s) nucl 15.5, mito_nucl 13.333, cyto_nucl 9.666, mito 9
Family & Domain DBs
Amino Acid Sequences MVRGTGKFKGYRRGGGRNFSKHLNGDGTTVSTDDWMKRRRLRKMKRTKRKMEQEMNKEGQAFHNSNSVARRGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.69
4 0.65
5 0.64
6 0.58
7 0.55
8 0.46
9 0.43
10 0.37
11 0.29
12 0.23
13 0.21
14 0.18
15 0.15
16 0.14
17 0.11
18 0.09
19 0.09
20 0.1
21 0.16
22 0.19
23 0.24
24 0.3
25 0.37
26 0.47
27 0.57
28 0.65
29 0.7
30 0.78
31 0.84
32 0.89
33 0.93
34 0.93
35 0.92
36 0.93
37 0.92
38 0.91
39 0.9
40 0.87
41 0.85
42 0.78
43 0.69
44 0.59
45 0.49
46 0.43
47 0.4
48 0.33
49 0.25
50 0.27
51 0.26
52 0.29
53 0.31
54 0.29