Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DS36

Protein Details
Accession E9DS36   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
106-130SGMVALKPRDRSKKKAKAKKKKAASBasic
NLS Segment(s)
PositionSequence
112-130KPRDRSKKKAKAKKKKAAS
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG maw:MAC_00109  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MRYSHTTNPAEQFFSKLDELFTQRKGASHGAVYLTQKRLMSHTEEDTMEKSDAGSDQYPTGPMPVLIRASNGKSKRNRSDKIKMSTIVEPHDLDSFYIRFADICKSGMVALKPRDRSKKKAKAKKKKAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.22
4 0.21
5 0.21
6 0.26
7 0.26
8 0.27
9 0.26
10 0.25
11 0.26
12 0.28
13 0.27
14 0.24
15 0.21
16 0.21
17 0.19
18 0.22
19 0.24
20 0.26
21 0.25
22 0.26
23 0.25
24 0.24
25 0.24
26 0.24
27 0.26
28 0.24
29 0.24
30 0.24
31 0.24
32 0.25
33 0.24
34 0.24
35 0.19
36 0.15
37 0.12
38 0.1
39 0.1
40 0.11
41 0.1
42 0.08
43 0.09
44 0.09
45 0.1
46 0.09
47 0.09
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.09
55 0.1
56 0.12
57 0.19
58 0.21
59 0.27
60 0.33
61 0.41
62 0.5
63 0.57
64 0.62
65 0.64
66 0.71
67 0.73
68 0.72
69 0.69
70 0.61
71 0.55
72 0.52
73 0.45
74 0.38
75 0.31
76 0.25
77 0.22
78 0.21
79 0.18
80 0.15
81 0.15
82 0.13
83 0.11
84 0.11
85 0.1
86 0.08
87 0.09
88 0.13
89 0.12
90 0.13
91 0.12
92 0.13
93 0.14
94 0.17
95 0.19
96 0.22
97 0.28
98 0.34
99 0.41
100 0.49
101 0.59
102 0.62
103 0.69
104 0.73
105 0.77
106 0.81
107 0.85
108 0.89
109 0.89
110 0.94