Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3IU65

Protein Details
Accession A0A0C3IU65    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
17-36LSLARRGKRRNKETGYNKCGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
Amino Acid Sequences MRVLPCSVGSPALHSTLSLARRGKRRNKETGYNKCGMDGSLKESSSSEELPKAGRVKWDRSVPMPSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.21
5 0.22
6 0.25
7 0.28
8 0.37
9 0.46
10 0.53
11 0.59
12 0.64
13 0.69
14 0.71
15 0.76
16 0.79
17 0.8
18 0.77
19 0.7
20 0.62
21 0.52
22 0.46
23 0.36
24 0.29
25 0.19
26 0.17
27 0.17
28 0.18
29 0.17
30 0.17
31 0.19
32 0.19
33 0.19
34 0.16
35 0.14
36 0.15
37 0.16
38 0.2
39 0.21
40 0.2
41 0.28
42 0.31
43 0.36
44 0.43
45 0.49
46 0.49
47 0.51