Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9EI83

Protein Details
Accession E9EI83   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
76-99PVTPTKATPKRKTRAPKTKPAEFDHydrophilic
NLS Segment(s)
PositionSequence
84-93PKRKTRAPKT
Subcellular Location(s) nucl 19.5, cyto_nucl 12.833, mito_nucl 12.166, cyto 4
Family & Domain DBs
KEGG maw:MAC_09581  -  
Amino Acid Sequences MSRPPVTHKWDENSHLGLLRAMIEVARPNKDFLVKVAEHMQSQGFSTTFGGVNQHIQKLRRTQDSPEKTAKTGSVPVTPTKATPKRKTRAPKTKPAEFDDADDEITVKEEQYYDDDQGEPETKRVKKDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.34
4 0.27
5 0.21
6 0.18
7 0.13
8 0.1
9 0.08
10 0.08
11 0.13
12 0.16
13 0.2
14 0.2
15 0.21
16 0.23
17 0.25
18 0.25
19 0.21
20 0.25
21 0.21
22 0.22
23 0.27
24 0.26
25 0.24
26 0.24
27 0.23
28 0.16
29 0.16
30 0.15
31 0.09
32 0.09
33 0.09
34 0.1
35 0.09
36 0.09
37 0.1
38 0.09
39 0.14
40 0.15
41 0.17
42 0.19
43 0.2
44 0.23
45 0.28
46 0.32
47 0.34
48 0.34
49 0.36
50 0.44
51 0.48
52 0.49
53 0.49
54 0.46
55 0.4
56 0.39
57 0.35
58 0.26
59 0.25
60 0.22
61 0.19
62 0.2
63 0.2
64 0.22
65 0.21
66 0.21
67 0.26
68 0.32
69 0.38
70 0.46
71 0.55
72 0.58
73 0.67
74 0.76
75 0.78
76 0.81
77 0.8
78 0.81
79 0.79
80 0.81
81 0.77
82 0.72
83 0.68
84 0.57
85 0.52
86 0.45
87 0.39
88 0.31
89 0.25
90 0.2
91 0.13
92 0.14
93 0.12
94 0.08
95 0.08
96 0.08
97 0.09
98 0.13
99 0.16
100 0.16
101 0.18
102 0.18
103 0.18
104 0.21
105 0.24
106 0.2
107 0.21
108 0.28
109 0.3
110 0.34