Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PUG1

Protein Details
Accession A0A0C3PUG1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-78TIVHRHYLARRQRRKHYLTGGEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MYSIVRNVDLRSGGSSDMSAVRLPLWNLRCRLRYCISPAELPLLTNPDVSTSRTMLTIVHRHYLARRQRRKHYLTGGEQVIGIRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.13
5 0.12
6 0.1
7 0.09
8 0.1
9 0.11
10 0.12
11 0.17
12 0.2
13 0.23
14 0.27
15 0.32
16 0.36
17 0.37
18 0.42
19 0.39
20 0.39
21 0.39
22 0.41
23 0.38
24 0.34
25 0.32
26 0.29
27 0.26
28 0.22
29 0.17
30 0.14
31 0.12
32 0.11
33 0.11
34 0.1
35 0.11
36 0.12
37 0.14
38 0.12
39 0.12
40 0.12
41 0.12
42 0.11
43 0.15
44 0.2
45 0.21
46 0.22
47 0.22
48 0.23
49 0.27
50 0.34
51 0.39
52 0.44
53 0.52
54 0.58
55 0.68
56 0.78
57 0.8
58 0.8
59 0.8
60 0.79
61 0.76
62 0.75
63 0.66
64 0.57
65 0.51