Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3JX83

Protein Details
Accession A0A0C3JX83   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-28VYGCSSLYGRQHRRKKNLLRYTPSVSRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
Amino Acid Sequences MVYGCSSLYGRQHRRKKNLLRYTPSVSRHQSGRVPVRVMPCCSAVKTTFWLGLDILAALFPTSGAGLAVAYELRIYHNPKVQVPESKTKARPRDLDRGCRSHNIQYTRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.84
3 0.87
4 0.88
5 0.88
6 0.88
7 0.86
8 0.82
9 0.81
10 0.77
11 0.71
12 0.67
13 0.6
14 0.53
15 0.47
16 0.45
17 0.42
18 0.42
19 0.46
20 0.43
21 0.4
22 0.4
23 0.45
24 0.44
25 0.42
26 0.36
27 0.31
28 0.28
29 0.27
30 0.26
31 0.21
32 0.18
33 0.18
34 0.18
35 0.16
36 0.15
37 0.15
38 0.12
39 0.11
40 0.1
41 0.07
42 0.06
43 0.04
44 0.03
45 0.03
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.03
53 0.02
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.05
61 0.09
62 0.13
63 0.17
64 0.22
65 0.25
66 0.27
67 0.33
68 0.35
69 0.4
70 0.42
71 0.48
72 0.49
73 0.54
74 0.59
75 0.63
76 0.67
77 0.67
78 0.7
79 0.67
80 0.72
81 0.72
82 0.76
83 0.75
84 0.74
85 0.71
86 0.69
87 0.67
88 0.65
89 0.65