Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3N8N7

Protein Details
Accession A0A0C3N8N7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MHRHRLSRVQRRKRSQLPRQAHQLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHRHRLSRVQRRKRSQLPRQAHQLPVIPLPQLLRHRSPPLRQSLRPPRDNNVPRVLGASVRSNAVRKALVAAATPRARLTKHDFFVAVIDNCYANAPPVPVLFHVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.9
4 0.87
5 0.84
6 0.84
7 0.79
8 0.71
9 0.63
10 0.57
11 0.49
12 0.43
13 0.36
14 0.27
15 0.23
16 0.21
17 0.23
18 0.24
19 0.26
20 0.27
21 0.3
22 0.38
23 0.43
24 0.47
25 0.47
26 0.52
27 0.54
28 0.53
29 0.59
30 0.62
31 0.65
32 0.67
33 0.63
34 0.58
35 0.62
36 0.64
37 0.58
38 0.52
39 0.45
40 0.37
41 0.36
42 0.31
43 0.22
44 0.19
45 0.17
46 0.12
47 0.12
48 0.13
49 0.13
50 0.13
51 0.14
52 0.13
53 0.1
54 0.12
55 0.12
56 0.12
57 0.12
58 0.13
59 0.18
60 0.18
61 0.19
62 0.18
63 0.18
64 0.18
65 0.22
66 0.3
67 0.32
68 0.33
69 0.34
70 0.34
71 0.32
72 0.34
73 0.34
74 0.26
75 0.18
76 0.17
77 0.15
78 0.15
79 0.15
80 0.14
81 0.1
82 0.1
83 0.1
84 0.11
85 0.12
86 0.14
87 0.14