Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E7M1

Protein Details
Accession E9E7M1   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
90-114LRHPRAPHRLRTRRGRPPRRPLAPLBasic
NLS Segment(s)
PositionSequence
91-127RHPRAPHRLRTRRGRPPRRPLAPLRHSRPHPRPGRAR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
KEGG maw:MAC_05869  -  
Amino Acid Sequences MRDCTSHDTQYAKELSSSPSNHSFTQLLPSTTKRNPCPTPAPDAAASWPTTPSPPNQPTSPPRPLKVRLSIRQAWVSPDSPPQKALQATLRHPRAPHRLRTRRGRPPRRPLAPLRHSRPHPRPGRARAAHDELPDDEAVAGRLLEAMAQRGVRTLRLAIPKQDGTRSGAQASRCSSRMSRASPHRDFGAQITSASDAKTELDAADGTATNGLSRERYPEPRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.32
4 0.33
5 0.31
6 0.37
7 0.4
8 0.38
9 0.4
10 0.36
11 0.29
12 0.35
13 0.33
14 0.28
15 0.28
16 0.31
17 0.34
18 0.39
19 0.46
20 0.44
21 0.5
22 0.51
23 0.54
24 0.6
25 0.56
26 0.58
27 0.53
28 0.51
29 0.44
30 0.41
31 0.36
32 0.3
33 0.28
34 0.2
35 0.18
36 0.15
37 0.16
38 0.16
39 0.17
40 0.24
41 0.28
42 0.31
43 0.32
44 0.38
45 0.44
46 0.5
47 0.57
48 0.51
49 0.51
50 0.53
51 0.57
52 0.57
53 0.59
54 0.61
55 0.57
56 0.61
57 0.61
58 0.58
59 0.57
60 0.51
61 0.44
62 0.38
63 0.32
64 0.26
65 0.29
66 0.29
67 0.26
68 0.26
69 0.24
70 0.24
71 0.24
72 0.25
73 0.24
74 0.25
75 0.29
76 0.37
77 0.39
78 0.37
79 0.38
80 0.42
81 0.46
82 0.47
83 0.51
84 0.53
85 0.6
86 0.66
87 0.75
88 0.78
89 0.78
90 0.84
91 0.86
92 0.84
93 0.86
94 0.88
95 0.82
96 0.78
97 0.75
98 0.74
99 0.72
100 0.7
101 0.66
102 0.64
103 0.63
104 0.66
105 0.66
106 0.65
107 0.64
108 0.63
109 0.65
110 0.65
111 0.71
112 0.65
113 0.64
114 0.59
115 0.58
116 0.53
117 0.45
118 0.4
119 0.3
120 0.28
121 0.23
122 0.17
123 0.11
124 0.08
125 0.08
126 0.07
127 0.06
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.06
134 0.07
135 0.07
136 0.07
137 0.1
138 0.1
139 0.1
140 0.11
141 0.12
142 0.16
143 0.23
144 0.25
145 0.27
146 0.32
147 0.35
148 0.35
149 0.36
150 0.33
151 0.3
152 0.33
153 0.31
154 0.28
155 0.28
156 0.27
157 0.29
158 0.31
159 0.3
160 0.27
161 0.28
162 0.27
163 0.31
164 0.36
165 0.37
166 0.42
167 0.48
168 0.57
169 0.57
170 0.59
171 0.54
172 0.49
173 0.46
174 0.39
175 0.35
176 0.25
177 0.22
178 0.2
179 0.19
180 0.19
181 0.18
182 0.15
183 0.1
184 0.11
185 0.11
186 0.1
187 0.08
188 0.09
189 0.09
190 0.09
191 0.11
192 0.1
193 0.09
194 0.1
195 0.1
196 0.09
197 0.1
198 0.11
199 0.11
200 0.12
201 0.18
202 0.23